Protein Information |
Information Type | Description |
---|---|
Protein name | PTS system galactitol-specific EIIB component (EIIB-Gat) (Galactitol-specific phosphotransferase enzyme IIB component) (EC 2.7.1.200) |
NCBI Accession ID | AE014075.1 |
Organism | Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) |
Left | 2464324 |
Right | 2464608 |
Strand | - |
Nucleotide Sequence | ATGAAACGCAAAATTATTGTCGCTTGCGGAGGCGCGGTTGCGACCTCTACGATGGCGGCGGAAGAAATTAAAGAGTTGTGTCAGAGTCATAATATTCCTGTTGAATTAATCCAGTGTCGGGTTAATGAAATAGAAACCTATATGGATGGCGTGCATTTGATATGCACCACTGCCAGGGTGGATCGTAGTTTTGGCGATATTCCGTTAGTTCACGGCATGCCTTTTGTTTCTGGTGTCGGTATCGAAGCATTACAAAATAAAATTCTGACTATCTTACAGGGGTGA |
Sequence | MKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG |
Source of smORF | Swiss-Prot |
Function | The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The enzyme II complex composed of GatA, GatB and GatC is involved in galactitol transport. {ECO:0000250|UniProtKB:P37188}. |
Pubmed ID | 12471157 16963640 |
Domain | CDD:415825 |
Functional Category | Others |
Uniprot ID | P0A435 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2179959 | 2180243 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
2 | 2847959 | 2848243 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 2174282 | 2174566 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
4 | 1626366 | 1626626 | + | NZ_CP061527.1 | Shigella dysenteriae |
5 | 610991 | 611275 | - | NZ_CP045845.1 | Kluyvera intermedia |
6 | 4730868 | 4731152 | + | NZ_CP015113.1 | Kosakonia radicincitans |
7 | 553231 | 553515 | - | NZ_CP035129.1 | Kosakonia cowanii |
8 | 2987919 | 2988203 | - | NZ_CP044098.1 | Citrobacter portucalensis |
9 | 2093379 | 2093663 | + | NZ_CP033744.1 | Citrobacter freundii |
10 | 593081 | 593365 | - | NZ_CP014007.2 | Kosakonia oryzae |
11 | 4037368 | 4037652 | + | NZ_AP022508.1 | Enterobacter bugandensis |
12 | 3529808 | 3530092 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
13 | 1284355 | 1284639 | + | NZ_CP053416.1 | Salmonella bongori |
14 | 714284 | 714568 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
15 | 3178972 | 3179256 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
16 | 495168 | 495452 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
17 | 4706677 | 4706961 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
18 | 4988104 | 4988388 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
19 | 3453852 | 3454136 | - | NZ_CP057657.1 | Escherichia fergusonii |
20 | 3428617 | 3428901 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
21 | 1483795 | 1484079 | + | NZ_CP011254.1 | Serratia fonticola |
22 | 2513930 | 2514214 | + | NZ_CP067057.1 | Rahnella aceris |
23 | 179242 | 179526 | + | NZ_CP007445.1 | Gilliamella apicola |
24 | 754004 | 754288 | - | NZ_CP028105.1 | Fusobacterium ulcerans |
25 | 439976 | 440260 | + | NZ_CP036523.1 | Peptacetobacter hiranonis |
26 | 480869 | 481150 | + | NC_015389.1 | Coriobacterium glomerans PW2 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00455.24 | 0.84 | 21 | 2578.0 | same-strand | DeoR C terminal sensor domain |
2 | PF08220.14 | 0.84 | 21 | 2578 | same-strand | DeoR-like helix-turn-helix domain |
3 | PF00392.23 | 0.76 | 19 | 2578.5 | same-strand | Bacterial regulatory proteins, gntR family |
4 | PF08240.14 | 0.96 | 24 | 1423 | same-strand | Alcohol dehydrogenase GroES-like domain |
5 | PF00107.28 | 0.92 | 23 | 1423.5 | same-strand | Zinc-binding dehydrogenase |
6 | PF16912.7 | 0.72 | 18 | 1423 | same-strand | Glucose dehydrogenase C-terminus |
7 | PF03611.16 | 0.96 | 24 | 5.0 | same-strand | PTS system sugar-specific permease component |
8 | PF00359.24 | 0.96 | 24 | 30 | same-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
9 | PF08013.13 | 0.8 | 20 | 509 | same-strand | D-tagatose-1,6-bisphosphate aldolase subunit GatZ/KbaZ-like |
10 | PF01116.22 | 0.76 | 19 | 1867.5 | same-strand | Fructose-bisphosphate aldolase class-II |