Result : A4SCK2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | CP000607.1 |
| Organism | Chlorobium phaeovibrioides (strain DSM 265 / 1930) (Prosthecochloris vibrioformis (strain DSM 265)) |
| Left | 205905 |
| Right | 206102 |
| Strand | - |
| Nucleotide Sequence | ATGCCTAAAATGAAATCGCACCGCGGTGCCTGCAAACGGTTCAAAGCCACTGCTTCAGGAAGAATCAAACGAGAGAGAATGAACGGCTCGCACAACCTCGAACACAAAAACAGGAAGCGCACGCGCCGTCTCCACCAGTCCGCACTCCTCGAGTGCACAAAAAAGGAACGGCAGATCAAGCGAATGATTCTGGCATAA |
| Sequence | MPKMKSHRGACKRFKATASGRIKRERMNGSHNLEHKNRKRTRRLHQSALLECTKKERQIKRMILA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A4SCK2 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 72
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2016045 | 2016239 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 2 | 132746 | 132943 | - | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 3 | 133706 | 133900 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 4 | 2625220 | 2625414 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 5 | 171073 | 171267 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 6 | 172075 | 172269 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 7 | 2871666 | 2871860 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 8 | 169614 | 169808 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 9 | 2380823 | 2381017 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 10 | 2831063 | 2831260 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 11 | 2011687 | 2011884 | - | NZ_CP012154.1 | Wenzhouxiangella marina |
| 12 | 2088705 | 2088899 | + | NC_014666.1 | Frankia inefficax |
| 13 | 810951 | 811148 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 14 | 1654253 | 1654450 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 15 | 3664965 | 3665162 | + | NZ_CP030356.1 | Salinibacter ruber |
| 16 | 1782707 | 1782907 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 17 | 456857 | 457054 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 18 | 773189 | 773386 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 19 | 3167593 | 3167787 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 20 | 1599821 | 1600015 | - | NC_012803.1 | Micrococcus luteus NCTC 2665 |
| 21 | 1883562 | 1883759 | + | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 22 | 3793895 | 3794092 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 23 | 1649982 | 1650173 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 24 | 2223799 | 2223996 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 25 | 1001641 | 1001838 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 26 | 2196038 | 2196232 | - | NZ_AP021853.1 | Sporolactobacillus terrae |
| 27 | 1799580 | 1799777 | + | NZ_CP045851.1 | Actinomarinicola tropica |
| 28 | 3604213 | 3604410 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 29 | 1591668 | 1591865 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 30 | 2385893 | 2386090 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 31 | 74509 | 74703 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 32 | 542751 | 542948 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 33 | 115547 | 115744 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 34 | 1751870 | 1752064 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 35 | 2366871 | 2367065 | - | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 36 | 3918903 | 3919100 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 37 | 1742616 | 1742810 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 38 | 175941 | 176138 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 39 | 266479 | 266676 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 40 | 1552719 | 1552916 | - | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 41 | 1312855 | 1313049 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 42 | 6026852 | 6027046 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 43 | 1703837 | 1704031 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 44 | 3039253 | 3039447 | - | NZ_CP035491.1 | Agromyces protaetiae |
| 45 | 1664628 | 1664825 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 46 | 3567042 | 3567239 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 47 | 1597413 | 1597607 | - | NZ_CP023693.1 | Streptomyces cinereoruber |
| 48 | 119835 | 120032 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 49 | 297056 | 297256 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 50 | 1174259 | 1174456 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 51 | 2431404 | 2431598 | + | NZ_CP022295.1 | Nocardioides aromaticivorans |
| 52 | 2554941 | 2555135 | + | NZ_CP009896.1 | Pimelobacter simplex |
| 53 | 16768 | 16962 | - | NZ_CP041146.1 | Nocardioides humi |
| 54 | 1196506 | 1196703 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 55 | 2295869 | 2296063 | + | NZ_AP017372.2 | Halorhodospira halochloris |
| 56 | 871979 | 872176 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 57 | 1992799 | 1992996 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 58 | 3530107 | 3530301 | + | NZ_CP038436.1 | Nocardioides seonyuensis |
| 59 | 2675909 | 2676103 | + | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 60 | 1286620 | 1286814 | - | NZ_CP041091.1 | Nocardioides sambongensis |
| 61 | 588735 | 588932 | + | NZ_CP017774.1 | Flavobacterium commune |
| 62 | 29671 | 29868 | + | NZ_CP029255.1 | Flavobacterium crocinum |
| 63 | 1354185 | 1354382 | - | NZ_CP017688.1 | Flavobacterium crassostreae |
| 64 | 2505571 | 2505768 | - | NZ_CP020918.1 | Flavobacterium faecale |
| 65 | 2786215 | 2786412 | - | NZ_CP016907.1 | Flavobacterium anhuiense |
| 66 | 2706421 | 2706618 | - | NZ_CP043612.1 | Flavobacterium nitrogenifigens |
| 67 | 1674565 | 1674765 | - | NZ_LR134374.1 | Legionella spiritensis |
| 68 | 3405666 | 3405866 | - | NZ_LT906442.1 | Legionella waltersii |
| 69 | 2885709 | 2885909 | - | NZ_LN681225.1 | Legionella hackeliae |
| 70 | 93688 | 93879 | - | NZ_CP059443.1 | Campylobacter fetus |
| 71 | 120024 | 120215 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 72 | 124010 | 124201 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002932.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00587.27 | 0.64 | 46 | 685.5 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 2 | PF03129.22 | 0.62 | 45 | 684 | same-strand | Anticodon binding domain |
| 3 | PF07973.16 | 0.64 | 46 | 685.5 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 4 | PF05198.18 | 0.65 | 47 | 48 | same-strand | Translation initiation factor IF-3, N-terminal domain |
| 5 | PF00707.24 | 0.94 | 68 | 48.0 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 6 | PF00453.20 | 1.0 | 72 | 46.5 | same-strand | Ribosomal protein L20 |
| 7 | PF01409.22 | 0.76 | 55 | 737.0 | same-strand | tRNA synthetases class II core domain (F) |
| 8 | PF02912.20 | 0.76 | 55 | 674 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
++ More..