Protein Information |
Information Type | Description |
---|---|
Protein name | Outer membrane lipoprotein virB7 |
NCBI Accession ID | AF242881.1 |
Organism | Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) |
Left | 156721 |
Right | 156888 |
Strand | + |
Nucleotide Sequence | ATGAAATATTGCCTGCTGTGCCTAGTTGTCGCTTTGAGCGGCTGCCAGACAAATGACACAATAGCGAGCTGCAAAGGCCCGATTTTCCCGCTGAATGTGGGGCGATGGCAGCCTACTCCGTCAGATCTTCAGCTCCGCAATTCGGGTGGACGCTATGACGGGGCCTGA |
Sequence | MKYCLLCLVVALSGCQTNDTIASCKGPIFPLNVGRWQPTPSDLQLRNSGGRYDGA |
Source of smORF | Swiss-Prot |
Function | Is essential for the biogenesis of the T-pilus, which is required for virulence and T-DNA transfer to plant cells. When is associated with virB9, might function as a nucleation center for recruitment of VirB proteins during assembly of the T-DNA transfer machine. |
Pubmed ID | 3281947 2307685 8655494 11371529 8799123 |
Domain | CDD:353374 |
Functional Category | Others |
Uniprot ID | P0A3W4 |
ORF Length (Amino Acid) | 55 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 255617 | 255775 | + | NZ_CP054024.1 | Rhizobium indicum |
2 | 150213 | 150371 | - | NZ_CP054030.1 | Rhizobium hidalgonense |
3 | 6009727 | 6009885 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
4 | 6329601 | 6329759 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
5 | 194496 | 194654 | - | NZ_CP050297.1 | Mesorhizobium huakuii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04956.15 | 1.0 | 5 | 4360 | same-strand | TrbC/VIRB2 pilin |
2 | PF05101.15 | 1.0 | 5 | 4037 | same-strand | Type IV secretory pathway, VirB3-like protein |
3 | PF03135.16 | 1.0 | 5 | 1668 | same-strand | CagE, TrbE, VirB family, component of type IV transporter system |
4 | PF04610.16 | 1.0 | 5 | 27 | same-strand | TrbL/VirB6 plasmid conjugal transfer protein |
5 | PF04335.15 | 1.0 | 5 | -3 | same-strand | VirB8 protein |
6 | PF03524.17 | 0.8 | 4 | 707.0 | same-strand | Conjugal transfer protein |
7 | PF03743.16 | 1.0 | 5 | 1585 | same-strand | Bacterial conjugation TrbI-like protein |
8 | PF00437.22 | 1.0 | 5 | 2708 | same-strand | Type II/IV secretion system protein |