Result : P0A3T8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable spore germination protein GerPD |
| NCBI Accession ID | AE016877.1 |
| Organism | Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) |
| Left | 1125310 |
| Right | 1125504 |
| Strand | - |
| Nucleotide Sequence | ATGAACCTTAACGTTGTAAACCGTGAGTTAAAAGTCGGACAGATTAAAATGAACGGTGTATCGTCGTCCGCACTCTTTTTAATTGGAGATGCAAATCTCCTCATTCTATCTTCTATTCTCGATACACCATTTGAAACAGTTACAGAGGGTCCATTTGTACCATTAGTAACAGATGTCCCTCCTACTCCAGGTTAA |
| Sequence | MNLNVVNRELKVGQIKMNGVSSSALFLIGDANLLILSSILDTPFETVTEGPFVPLVTDVPPTPG |
| Source of smORF | Swiss-Prot |
| Function | Required for the formation of functionally normal spores. Could be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor (By similarity). {ECO:0000250}. |
| Pubmed ID | 12721630 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P0A3T8 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 49
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1167371 | 1167565 | - | NC_011725.1 | Bacillus cereus B4264 |
| 2 | 3962465 | 3962659 | + | NZ_CP040336.1 | Bacillus luti |
| 3 | 1102991 | 1103185 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 4 | 1135446 | 1135640 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 5 | 1120374 | 1120568 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 6 | 975630 | 975824 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 7 | 624004 | 624180 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 8 | 1122730 | 1122915 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 9 | 1153463 | 1153645 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 10 | 840760 | 840942 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 11 | 6442466 | 6442645 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 12 | 1015573 | 1015755 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 13 | 2585790 | 2585981 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 14 | 579532 | 579708 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 15 | 1048525 | 1048701 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 16 | 447914 | 448090 | + | NZ_CP043404.1 | Bacillus safensis |
| 17 | 1149145 | 1149321 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 18 | 3292423 | 3292614 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 19 | 1356760 | 1356939 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 20 | 709612 | 709803 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 21 | 1575969 | 1576160 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 22 | 2989603 | 2989767 | + | NZ_LS483476.1 | Lederbergia lentus |
| 23 | 473102 | 473278 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 24 | 3376483 | 3376674 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 25 | 1128051 | 1128233 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 26 | 2019875 | 2020051 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 27 | 908526 | 908705 | - | NZ_CP012024.1 | Bacillus smithii |
| 28 | 3174578 | 3174760 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 29 | 207268 | 207444 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 30 | 1173631 | 1173810 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 31 | 1317950 | 1318126 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 32 | 3814094 | 3814273 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 33 | 1262573 | 1262755 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 34 | 1229136 | 1229312 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 35 | 1401160 | 1401348 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 36 | 1683831 | 1684007 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 37 | 150581 | 150757 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 38 | 888536 | 888712 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 39 | 1081838 | 1082014 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 40 | 1066903 | 1067079 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 41 | 1304151 | 1304327 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 42 | 2879788 | 2879964 | + | NZ_CP011937.1 | Bacillus velezensis |
| 43 | 1450214 | 1450393 | - | NZ_CP053989.1 | Niallia circulans |
| 44 | 6562148 | 6562333 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 45 | 1898443 | 1898622 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 46 | 547280 | 547477 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 47 | 3194000 | 3194176 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 48 | 2863248 | 2863454 | - | NZ_AP019400.1 | Cohnella abietis |
| 49 | 895983 | 896153 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011725.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10676.11 | 1.0 | 49 | 885.0 | same-strand | Spore germination protein gerPA/gerPF |
| 2 | PF10970.10 | 0.92 | 45 | 0 | same-strand | Spore germination protein GerPE |
| 3 | PF10737.11 | 0.98 | 48 | -3.0 | same-strand | Spore germination protein GerPC |
| 4 | PF10803.10 | 0.98 | 48 | 674.0 | same-strand | Spore germination GerPB |
++ More..