Result : P0A3T6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable spore germination protein GerPB |
| NCBI Accession ID | AE016877.1 |
| Organism | Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) |
| Left | 1126193 |
| Right | 1126399 |
| Strand | - |
| Nucleotide Sequence | TTGAATTTTTATGTAAACCAAAGTATCATCATCAACAGTATTAAAATTGATAGCATTACAACCTCTTCTGTGTTCCAAATTGGTACTGCCGGAAGTATTAAAGCCCTATCTAAATTTTCAAATACGGGCGGATTTACGGAACCGCTTCGCCCATTACAGGCAAAAGGACAAATTATTTCTATCAAACCATCAACTAGTTCTTCTTAA |
| Sequence | MNFYVNQSIIINSIKIDSITTSSVFQIGTAGSIKALSKFSNTGGFTEPLRPLQAKGQIISIKPSTSSS |
| Source of smORF | Swiss-Prot |
| Function | Required for the formation of functionally normal spores. Could be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor (By similarity). {ECO:0000250}. |
| Pubmed ID | 12721630 |
| Domain | CDD:393434 |
| Functional Category | Others |
| Uniprot ID | P0A3T6 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1168254 | 1168460 | - | NC_011725.1 | Bacillus cereus B4264 |
| 2 | 3961569 | 3961775 | + | NZ_CP040336.1 | Bacillus luti |
| 3 | 1121256 | 1121462 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 4 | 1136330 | 1136536 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 5 | 1103875 | 1104081 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 6 | 976510 | 976716 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 7 | 1067729 | 1067965 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 8 | 1082651 | 1082884 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 9 | 1318764 | 1318997 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 10 | 839888 | 840121 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 11 | 1016404 | 1016634 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 12 | 896814 | 897014 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 13 | 1897564 | 1897764 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 14 | 2020756 | 2020965 | - | NZ_CP017703.1 | Aeribacillus pallidus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011725.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10676.11 | 1.0 | 14 | 476.5 | same-strand | Spore germination protein gerPA/gerPF |
| 2 | PF10970.10 | 0.93 | 13 | 881 | same-strand | Spore germination protein GerPE |
| 3 | PF10737.11 | 1.0 | 14 | 67.5 | same-strand | Spore germination protein GerPC |
| 4 | PF09388.12 | 0.64 | 9 | 366 | same-strand | Spo0E like sporulation regulatory protein |
| 5 | PF01557.20 | 0.79 | 11 | 792 | opposite-strand | Fumarylacetoacetate (FAA) hydrolase family |
++ More..