ProsmORF-pred
Result : P0A3H5
Protein Information
Information Type Description
Protein name DNA-binding protein HU 1 (HSl)
NCBI Accession ID AL939114.1
Organism Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Left 171953
Right 172234
Strand -
Nucleotide Sequence ATGAACCGCAGTGAGCTGGTGGCCGCGCTGGCCGACCGCGCCGAGGTGACCCGCAAGGACGCCGACGCCGTGCTGGCCGCCTTCGCCGAGGTTGTCGGCGACATCGTCTCCAAGGGCGACGAGAAGGTCACCATCCCCGGCTTCCTGACTTTCGAGCGCACCCACCGTGCCGCTCGCACCGCCCGCAACCCGCAGACCGGCGAGCCGATCCAGATTCCGGCCGGCTACAGCGTCAAGGTCTCCGCGGGCTCCAAGCTCAAGGAAGCCGCCAAGGGCAAGTAG
Sequence MNRSELVAALADRAEVTRKDADAVLAAFAEVVGDIVSKGDEKVTIPGFLTFERTHRAARTARNPQTGEPIQIPAGYSVKVSAGSKLKEAAKGK
Source of smORF Swiss-Prot
Function Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. {ECO:0000250}.
Pubmed ID 12000953
Domain CDD:412265
Functional Category DNA-binding
Uniprot ID P0A3H5
ORF Length (Amino Acid) 93
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 243
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2162073 2162354 - NC_020990.1 Streptomyces albidoflavus
2 2587250 2587531 - NZ_CP031742.1 Streptomyces koyangensis
3 2983922 2984203 - NZ_CP023407.1 Streptomyces fungicidicus
4 2826996 2827277 - NZ_AP023439.1 Streptomyces tuirus
5 4801782 4802063 + NZ_CP022310.1 Streptomyces calvus
6 3457707 3457988 - NZ_CP021978.1 Streptomyces hawaiiensis
7 3531438 3531719 - NZ_CP015098.1 Streptomyces qaidamensis
8 3723917 3724198 - NZ_CP023694.1 Streptomyces coeruleorubidus
9 2783562 2783843 - NZ_CP015866.1 Streptomyces parvulus
10 5487646 5487927 + NZ_CP030073.1 Streptomyces cadmiisoli
11 3153789 3154070 - NZ_CP012382.1 Streptomyces ambofaciens ATCC 23877
12 3956939 3957220 - NZ_CP034539.1 Streptomyces cyaneochromogenes
13 9748322 9748603 - NZ_CP016279.1 Streptomyces griseochromogenes
14 3114237 3114518 - NZ_CP010849.1 Streptomyces cyaneogriseus subsp. noncyanogenus
15 5082817 5083098 + NZ_LN831790.1 Streptomyces leeuwenhoekii
16 6242782 6243063 + NC_013929.1 Streptomyces scabiei 87.22
17 3775066 3775347 - NZ_CP045096.1 Streptomyces phaeolivaceus
18 2315916 2316197 - NZ_CP032229.1 Streptomyces seoulensis
19 3088122 3088403 - NZ_CP023703.1 Streptomyces galilaeus
20 3548193 3548474 - NC_021985.1 Streptomyces collinus Tu 365
21 2205239 2205520 - NZ_CP029188.1 Streptomyces tirandamycinicus
22 1906380 1906661 - NZ_CP029254.1 Streptomyces spongiicola
23 6052548 6052829 + NZ_CP023689.1 Streptomyces chartreusis
24 3012723 3013004 - NZ_CP023695.1 Streptomyces alboniger
25 6227508 6227789 + NC_003155.5 Streptomyces avermitilis MA-4680 = NBRC 14893
26 5807232 5807513 + NZ_CP032427.1 Streptomyces griseorubiginosus
27 4231558 4231839 + NZ_CP054938.1 Streptomyces harbinensis
28 4276975 4277256 + NZ_CP022744.1 Streptomyces lincolnensis
29 5692607 5692888 + NZ_CP045643.1 Streptomyces fagopyri
30 5337635 5337916 + NZ_CP034687.1 Streptomyces griseoviridis
31 3185920 3186201 - NZ_CP063374.1 Streptomyces chromofuscus
32 4030591 4030872 - NZ_CP023690.1 Streptomyces spectabilis
33 4129305 4129586 + NZ_CP009922.3 Streptomyces xiamenensis
34 1357335 1357616 + NZ_CP063373.1 Streptomyces ferrugineus
35 5371135 5371416 + NZ_CP026652.1 Streptomyces dengpaensis
36 5899490 5899771 + NZ_AP023440.1 Streptomyces glomeroaurantiacus
37 2572872 2573153 - NZ_CP021080.1 Streptomyces pluripotens
38 2825471 2825752 - NZ_CP029043.1 Streptomyces nigra
39 6002779 6003060 + NZ_CP017248.1 Streptomyces fodineus
40 3963202 3963483 - NZ_CP047020.1 Streptomyces broussonetiae
41 3559469 3559750 - NZ_CP071839.1 Streptomyces cyanogenus
42 5351322 5351603 + NZ_CP051006.1 Streptomyces griseofuscus
43 2358455 2358736 - NZ_CP031264.1 Streptacidiphilus bronchialis
44 4766039 4766320 + NZ_CP023698.1 Streptomyces viridifaciens
45 6255889 6256170 + NZ_CP023699.1 Streptomyces kanamyceticus
46 3643828 3644109 - NZ_CP022685.1 Streptomyces formicae
47 4368508 4368789 - NZ_CP034463.1 Streptomyces aquilus
48 3226212 3226493 - NC_016109.1 Kitasatospora setae KM-6054
49 2661732 2662013 - NZ_CP042266.1 Streptomyces qinzhouensis
50 2779552 2779833 - NZ_CP020700.1 Streptomyces tsukubensis
51 3707813 3708094 - NZ_CP020569.1 Streptomyces gilvosporeus
52 4433934 4434215 + NZ_CP065253.1 Streptomyces clavuligerus
53 3344918 3345199 - NZ_CP019457.1 Streptomyces lydicus
54 2510372 2510653 - NZ_CP031194.1 Streptomyces paludis
55 3427737 3428018 - NZ_CP023691.1 Streptomyces platensis
56 5340208 5340489 + NZ_CP011340.1 Streptomyces pristinaespiralis
57 2956028 2956309 - NZ_CP072931.1 Streptomyces auratus AGR0001
58 2575412 2575693 - NZ_CP024957.1 Streptomyces cavourensis
59 5741540 5741818 + NZ_CP060404.1 Streptomyces buecherae
60 5306414 5306695 + NZ_CP032698.1 Streptomyces hundungensis
61 4577011 4577292 + NZ_CP034279.1 Streptomyces ficellus
62 2926441 2926722 - NZ_CP013738.1 Streptomyces globisporus C-1027
63 2772705 2772986 - NZ_CP070242.1 Streptomyces californicus
64 2882669 2882950 - NC_021177.1 Streptomyces fulvissimus DSM 40593
65 2759858 2760139 - NZ_CP020570.1 Streptomyces violaceoruber
66 2665419 2665700 - NZ_CP020563.1 Kitasatospora albolonga
67 5386049 5386330 + NC_010572.1 Streptomyces griseus subsp. griseus NBRC 13350
68 3565986 3566267 - NZ_CP027306.1 Streptomyces atratus
69 2304060 2304341 - NZ_CP017316.1 Streptomyces rubrolavendulae
70 2448124 2448405 - NZ_CP023696.1 Streptomyces fradiae ATCC 10745 = DSM 40063
71 7913404 7913685 + NC_016582.1 Streptomyces bingchenggensis BCW-1
72 6026265 6026546 - NZ_CP030862.1 Streptomyces globosus
73 4690031 4690312 + NZ_CP023701.1 Streptomyces subrutilus
74 3784148 3784429 - NZ_CP071139.1 Streptomyces nojiriensis
75 4844322 4844603 + NZ_CP023702.1 Streptomyces nitrosporeus
76 4776947 4777228 - NZ_CP065050.1 Streptomyces solisilvae
77 3503766 3504047 - NZ_CP059991.1 Streptomyces gardneri
78 2817689 2817970 - NZ_CP029196.1 Streptomyces venezuelae
79 2848586 2848867 - NZ_CP072827.1 Streptomyces mobaraensis NBRC 13819 = DSM 40847
80 3273697 3273978 - NZ_CP010407.1 Streptomyces vietnamensis
81 4175890 4176171 - NZ_CP031455.1 Streptomyces olivoreticuli subsp. olivoreticuli
82 2816251 2816532 - NZ_CP040752.1 Streptomyces rectiverticillatus
83 4510467 4510748 + NZ_CP023202.1 Streptomyces xinghaiensis S187
84 4132557 4132838 - NZ_CP070326.1 Streptomyces noursei
85 339224 339505 - NZ_CP023693.1 Streptomyces cinereoruber
86 2978012 2978293 - NZ_CP023693.1 Streptomyces cinereoruber
87 5847301 5847582 + NZ_CP023688.1 Streptomyces rimosus
88 7299013 7299294 - NZ_CP051486.1 Streptomyces pratensis
89 4617205 4617486 + NZ_CP023692.1 Streptomyces vinaceus
90 2080577 2080858 - NC_016111.1 Streptomyces cattleya NRRL 8057 = DSM 46488
91 5035646 5035927 + NZ_CP048882.1 Streptomyces bathyalis
92 59061 59339 + NZ_CP026952.1 Aeromicrobium chenweiae
93 59461 59739 + NZ_CP045737.1 Aeromicrobium yanjiei
94 684987 685262 + NZ_CP017812.1 Boudabousia tangfeifanii
95 3827011 3827298 - NZ_CP025333.1 Brevibacterium aurantiacum
96 2316207 2316491 - NZ_CP039292.1 Actinomyces procaprae
97 666903 667190 - NZ_CP065682.1 Brevibacterium casei
98 3618763 3619050 - NZ_CP026734.1 Brevibacterium linens
99 3440186 3440464 - NZ_CP011502.1 Aeromicrobium erythreum
100 2317859 2318137 + NZ_CP018135.1 Neomicrococcus aestuarii
101 695251 695535 - NZ_CP008802.1 Actinotignum schaalii
102 2542576 2542824 - NZ_CP033325.1 Georgenia faecalis
103 3491883 3492167 - NZ_CP013254.1 Kocuria flava
104 1742450 1742731 + NZ_LR134363.1 Actinomyces slackii
105 2473517 2473801 - NZ_CP012507.1 Kocuria palustris
106 4306810 4307097 - NZ_CP013979.1 Agromyces aureus
107 1272686 1272979 + NC_013729.1 Kribbella flavida DSM 17836
108 2984470 2984757 - NZ_CP028913.1 Agromyces badenianii
109 2551005 2551277 - NZ_CP058670.1 Chryseoglobus indicus
110 936552 936839 + NZ_CP035491.1 Agromyces protaetiae
111 396037 396315 + NZ_CP035504.1 Kocuria indica
112 2009804 2010091 - NZ_CP061538.1 Rothia amarae
113 926293 926574 + NZ_CP025227.1 Actinomyces wuliandei
114 2916255 2916533 - NZ_LR131272.1 Arthrobacter agilis
115 2770127 2770408 - NZ_CP066049.1 Actinomyces naeslundii
116 1722997 1723278 - NZ_CP066060.1 Actinomyces oris
117 323746 324027 + NZ_LR134477.1 Actinomyces viscosus
118 646472 646759 - NZ_CP018863.1 Arthrobacter crystallopoietes
119 5459024 5459317 + NZ_CP043661.1 Kribbella qitaiheensis
120 2164446 2164736 - NZ_CP035810.1 Brevibacterium luteolum
121 2891576 2891854 - NC_014550.1 Glutamicibacter arilaitensis Re117
122 2892134 2892412 - NC_014550.1 Glutamicibacter arilaitensis Re117
123 3752708 3752968 + NZ_CP013745.1 Arthrobacter alpinus
124 25695 25979 - NZ_CP014228.1 Actinomyces radicidentis
125 3057965 3058246 - NC_012669.1 Beutenbergia cavernae DSM 12333
126 311878 312165 - NZ_CP029642.1 Arthrobacter dokdonellae
127 2729056 2729334 - NZ_CP033081.1 Glutamicibacter nicotianae
128 2728497 2728775 - NZ_CP033081.1 Glutamicibacter nicotianae
129 2108975 2109259 - NZ_CP061539.1 Rothia terrae
130 710259 710543 + NZ_CP020468.1 Actinomyces gaoshouyii
131 902698 902985 + NZ_CP066802.1 Actinomyces weissii
132 1824 2105 + NZ_LR134350.1 Actinomyces howellii
133 92200 92481 + NZ_LT635457.1 Actinomyces pacaensis
134 2089436 2089723 - NZ_CP056080.1 Rothia nasimurium
135 1523294 1523572 - NZ_CP042260.1 Glutamicibacter halophytocola
136 1522737 1523015 - NZ_CP042260.1 Glutamicibacter halophytocola
137 565203 565478 + NZ_CP013290.1 Janibacter indicus
138 169432 169704 + NZ_CP026923.1 Pontimonas salivibrio
139 1118531 1118806 - NZ_CP066065.1 Schaalia meyeri
140 4018342 4018629 - NZ_CP020715.1 Cnuibacter physcomitrellae
141 583474 583761 + NZ_LR134357.1 Actinomyces israelii
142 1387955 1388233 - NZ_AP017457.1 Aurantimicrobium minutum
143 2154338 2154613 - NZ_CP045851.1 Actinomarinicola tropica
144 1874944 1875228 + NZ_LR134476.1 Trueperella bialowiezensis
145 109182 109460 - NC_014246.1 Mobiluncus curtisii ATCC 43063
146 2824038 2824325 - NZ_CP026949.1 Mycetocola zhujimingii
147 908153 908434 - NZ_CP034438.1 Flaviflexus salsibiostraticola
148 801204 801485 + NZ_CP041694.1 Cellulosimicrobium cellulans
149 2932648 2932929 + NZ_CP014209.1 Isoptericola dokdonensis DS-3
150 3628149 3628430 - NC_013530.1 Xylanimonas cellulosilytica DSM 15894
151 452670 452957 + NZ_CP017146.1 Marisediminicola antarctica
152 1769193 1769468 - NZ_CP044548.2 Janibacter melonis
153 1270949 1271230 - NZ_CP070228.1 Arcanobacterium phocisimile
154 2693636 2693893 - NZ_LS483423.1 Jonesia denitrificans
155 1643814 1644098 - NZ_CP053642.1 Actinomyces marmotae
156 2069877 2070152 - NC_012803.1 Micrococcus luteus NCTC 2665
157 953481 953762 + NZ_LS483427.1 Arcanobacterium haemolyticum
158 2725843 2726127 - NZ_CP035495.1 Xylanimonas allomyrinae
159 3610589 3610867 - NC_009664.2 Kineococcus radiotolerans SRS30216 = ATCC BAA-149
160 2573024 2573302 - NZ_CP034412.1 Glutamicibacter creatinolyticus
161 408255 408542 + NZ_CP015515.1 Rathayibacter tritici
162 73161 73448 + NZ_CP028129.1 Rathayibacter rathayi
163 2777271 2777558 - NZ_CP047186.1 Rathayibacter tanaceti
164 1761997 1762272 - NZ_CP051884.1 Cellulomonas taurus
165 4061533 4061817 - NC_013521.1 Sanguibacter keddieii DSM 10542
166 5175130 5175405 + NZ_CP011112.1 Luteipulveratus mongoliensis
167 787216 787497 - NZ_CP007519.1 Trueperella pyogenes
168 2252963 2253250 - NZ_CP028130.1 Rathayibacter iranicus
169 132976 133233 + NC_004572.3 Tropheryma whipplei str. Twist
170 2212997 2213311 - NZ_LR134479.1 Rothia aeria
171 2125400 2125681 + NC_015514.1 Cellulomonas fimi ATCC 484
172 418183 418470 + NZ_CP071883.1 Curtobacterium flaccumfaciens pv. flaccumfaciens
173 3799913 3800194 - NZ_CP045529.1 Luteimicrobium xylanilyticum
174 3526655 3526942 - NZ_CP047180.1 Rathayibacter festucae
175 2582117 2582401 - NC_022438.1 Leifsonia xyli subsp. cynodontis DSM 46306
176 314891 315175 - NC_013757.1 Geodermatophilus obscurus DSM 43160
177 124277 124552 - NZ_LR134418.1 Legionella adelaidensis
178 3761079 3761366 - NZ_CP068013.1 Paenarthrobacter ureafaciens
179 1400071 1400349 - NZ_CP007490.1 Rhodoluna lacicola
180 1839668 1839949 + NC_015671.1 Cellulomonas gilvus ATCC 13127
181 543509 543784 + NZ_CP022413.2 Blautia hansenii DSM 20583
182 2553012 2553248 - NZ_CP011005.1 Psychromicrobium lacuslunae
183 1429296 1429595 + NC_012778.1 [Eubacterium] eligens ATCC 27750
184 2812490 2812765 - NZ_CP030280.1 Blautia argi
185 3231493 3231780 - NZ_CP033724.1 Clavibacter michiganensis subsp. michiganensis
186 3165691 3165975 - NC_015588.1 Isoptericola variabilis 225
187 1389692 1389970 - NZ_CP040508.1 Rhodoluna limnophila
188 4488448 4488723 - NZ_CP039126.1 Blautia producta
189 3713828 3714103 - NZ_LR027880.1 Roseburia intestinalis L1-82
190 1848064 1848345 + NZ_CP039291.1 Cellulomonas shaoxiangyii
191 2424586 2424861 + NZ_CP070062.1 Coprococcus comes
192 4536082 4536354 + NC_009901.1 Shewanella pealeana ATCC 700345
193 1021479 1021757 + NZ_CP038254.1 Legionella israelensis
194 1271043 1271318 + NZ_CP036170.1 [Clostridium] scindens ATCC 35704
195 2090063 2090341 - NZ_CP013742.1 Legionella pneumophila
196 3392868 3393155 - NZ_CP031425.1 Microbacterium foliorum
197 505651 505926 + NZ_LR699011.1 Roseburia hominis
198 1166426 1166680 - NZ_CP032630.1 Protaetiibacter intestinalis
199 456052 456324 - NZ_CP022272.1 Shewanella marisflavi
200 482940 483212 - NC_009092.1 Shewanella loihica PV-4
201 1494611 1494883 + NZ_LN824141.1 Defluviitoga tunisiensis
202 2967507 2967794 + NZ_CP042326.1 Euhalothece natronophila Z-M001
203 2632876 2633160 - NC_019776.1 Cyanobacterium aponinum PCC 10605
204 3602654 3602929 - NC_014532.2 Halomonas elongata DSM 2581
205 247060 247335 + NZ_AP023367.1 Anaerocolumna cellulosilytica
206 1403176 1403454 + NZ_CP061344.1 Microbacterium hominis
207 67987 68265 - NC_015682.1 Thermodesulfobacterium geofontis OPF15
208 3492162 3492434 - NZ_CP017705.1 Brevibacillus laterosporus DSM 25
209 1491632 1491907 + NZ_CP048000.1 Anaerocolumna sedimenticola
210 128390 128668 - NZ_CP008796.1 Thermodesulfobacterium commune DSM 2178
211 1428156 1428434 - NZ_CP060716.1 Leucobacter denitrificans
212 596775 597062 + NC_019780.1 Dactylococcopsis salina PCC 8305
213 2114835 2115116 - NC_014151.1 Cellulomonas flavigena DSM 20109
214 1665232 1665519 - NZ_CP032624.1 Gryllotalpicola protaetiae
215 2553519 2553797 + NZ_CP038267.1 Nocardioides euryhalodurans
216 4573903 4574187 - NC_019695.1 Chroococcidiopsis thermalis PCC 7203
217 1555169 1555444 - NZ_CP068055.1 Sutterella wadsworthensis
218 1993912 1994190 - NZ_AP014638.1 Leptolyngbya boryana IAM M-101
219 195632 195910 + NZ_CP018762.1 Microbacterium aurum
220 264640 264903 + NZ_CP048877.1 Thermosulfuriphilus ammonigenes
221 3614634 3614924 + NC_019729.1 Oscillatoria nigro-viridis PCC 7112
222 2347610 2347894 - NC_019771.1 Anabaena cylindrica PCC 7122
223 1122737 1123012 + NC_009925.1 Acaryochloris marina MBIC11017
224 5966881 5967162 - NC_009925.1 Acaryochloris marina MBIC11017
225 4121984 4122271 - NZ_CP016282.1 Cryobacterium arcticum
226 2523192 2523479 + NZ_CP030033.1 Cryobacterium soli
227 797682 797957 + NC_011729.1 Gloeothece citriformis PCC 7424
228 642161 642439 + NZ_LR134527.1 Bartonella elizabethae
229 1366057 1366335 + NZ_CP031843.2 Bartonella kosoyi
230 5813530 5813814 + NZ_CP054698.1 Nostoc edaphicum CCNP1411
231 3479148 3479432 - NZ_CP047242.1 Trichormus variabilis 0441
232 458260 458544 - NZ_CP031941.1 Nostoc sphaeroides
233 8276994 8277278 - NZ_CP024785.1 Nostoc flagelliforme CCNUN1
234 1130859 1131134 - NC_014501.1 Gloeothece verrucosa PCC 7822
235 4944974 4945258 - NC_019751.1 Calothrix sp. PCC 6303
236 6207249 6207533 + NC_010628.1 Nostoc punctiforme PCC 73102
237 818469 818747 + NC_012846.1 Bartonella grahamii as4aup
238 5244696 5244980 - NC_019753.1 Crinalium epipsammum PCC 9333
239 547982 548257 - NZ_LT906446.1 Megamonas hypermegale
240 938842 939120 + NC_010161.1 Bartonella tribocorum CIP 105476
241 2362833 2363105 - NZ_CP031124.1 Ephemeroptericola cinctiostellae
242 693811 694086 + NZ_HG965802.1 Bartonella henselae
243 2800548 2800826 + NC_019693.1 Oscillatoria acuminata PCC 6304
244 2459292 2459570 - NC_019689.1 Pleurocapsa sp. PCC 7327
245 5007171 5007440 + NZ_AP017422.1 Filimonas lacunae
246 965697 965972 - NZ_CP044496.1 Lactobacillus acetotolerans
247 1410521 1410832 - NZ_LR134365.1 Cardiobacterium hominis
248 1271116 1271388 + NZ_AP020335.1 Hydrogenovibrio marinus
++ More..