Result : P0A3F7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative D-serine transporter DsdX-like protein |
| NCBI Accession ID | AE005674.2 |
| Organism | Shigella flexneri |
| Left | 2482028 |
| Right | 2482246 |
| Strand | + |
| Nucleotide Sequence | ATGCTGCCACTGTATCCCGACATCAGCCCGGAAATTATTGCGATTGCTATCGGTTCAGGTGCAATTGGCTGCACGATCGTTACGGACTCGCTTTTCTGGCTGGTGAAGCAATATTGCGGCGCTACGCTCAATGAAACATTTAAATACTATACGACAGCGACATTTATCGCTTCAGTCGTCGCTCTGGCGGGCACATTCCTGCTGTCATTTATCATCTAA |
| Sequence | MLPLYPDISPEIIAIAIGSGAIGCTIVTDSLFWLVKQYCGATLNETFKYYTTATFIASVVALAGTFLLSFII |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 12384590 12704152 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P0A3F7 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 87
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2467927 | 2468145 | + | NZ_AP014857.1 | Escherichia albertii |
| 2 | 2478966 | 2479184 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4004229 | 4004447 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 4 | 18681 | 18899 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 5 | 2482028 | 2482246 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 1250640 | 1250858 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 7 | 3207237 | 3207455 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 8 | 2759048 | 2759266 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 9 | 3216538 | 3216756 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 10 | 26521 | 26739 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 11 | 26411 | 26629 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 12 | 22828 | 23046 | - | NC_015968.1 | Enterobacter soli |
| 13 | 24766 | 24984 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 14 | 20147 | 20365 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 15 | 2561437 | 2561655 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 16 | 3449752 | 3449970 | - | NZ_CP038469.1 | Citrobacter tructae |
| 17 | 1343980 | 1344198 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 18 | 22971 | 23189 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 19 | 2641089 | 2641307 | + | NZ_CP033744.1 | Citrobacter freundii |
| 20 | 2438543 | 2438761 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 21 | 32820 | 33038 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 22 | 75750 | 75968 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 23 | 430075 | 430293 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 24 | 24371 | 24589 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 25 | 4601102 | 4601320 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 26 | 4633856 | 4634074 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 27 | 4293653 | 4293871 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 28 | 23885 | 24103 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 29 | 5210072 | 5210254 | - | NZ_CP023525.1 | Cedecea neteri |
| 30 | 4843813 | 4844028 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 31 | 1624906 | 1625124 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 32 | 3327316 | 3327492 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 33 | 880149 | 880367 | - | NZ_CP007445.1 | Gilliamella apicola |
| 34 | 3259447 | 3259665 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 35 | 18260 | 18478 | - | NZ_CP041247.1 | Raoultella electrica |
| 36 | 2974202 | 2974420 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 37 | 2342516 | 2342734 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 38 | 25131 | 25349 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 39 | 1701645 | 1701863 | + | NZ_CP026047.1 | Raoultella planticola |
| 40 | 15842 | 16051 | + | NZ_LR134531.1 | Pragia fontium |
| 41 | 2619428 | 2619646 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 42 | 24961 | 25179 | - | NZ_CP050508.1 | Raoultella terrigena |
| 43 | 381770 | 381997 | - | NZ_CP019959.1 | Vibrio owensii |
| 44 | 1678459 | 1678686 | + | NZ_CP009467.1 | Vibrio harveyi |
| 45 | 752186 | 752413 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 46 | 1119922 | 1120149 | + | NZ_CP018312.1 | Vibrio rotiferianus |
| 47 | 2672859 | 2673077 | - | NZ_LR134494.1 | Serratia quinivorans |
| 48 | 1612510 | 1612692 | + | NZ_CP044060.1 | Aeromonas veronii |
| 49 | 887487 | 887732 | - | NZ_AP019652.1 | Vibrio taketomensis |
| 50 | 3720907 | 3721083 | - | NZ_CP046293.1 | Yersinia intermedia |
| 51 | 3620180 | 3620398 | + | NZ_AP014630.1 | Acinetobacter guillouiae |
| 52 | 806677 | 806892 | + | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 53 | 4391982 | 4392179 | - | NZ_CP050150.1 | Hafnia alvei |
| 54 | 221341 | 221517 | + | NC_010554.1 | Proteus mirabilis HI4320 |
| 55 | 3727154 | 3727363 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 56 | 3842844 | 3843053 | + | NZ_CP009787.1 | Yersinia rohdei |
| 57 | 3152481 | 3152690 | - | NZ_CP032487.1 | Yersinia hibernica |
| 58 | 988793 | 989002 | + | NZ_CP043727.1 | Yersinia canariae |
| 59 | 1898588 | 1898770 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 60 | 1440189 | 1440371 | - | NZ_AP022188.1 | Aeromonas media |
| 61 | 2081084 | 2081266 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 62 | 5595855 | 5596031 | - | NZ_CP011254.1 | Serratia fonticola |
| 63 | 2406179 | 2406388 | + | NZ_CP026364.1 | Proteus hauseri |
| 64 | 3206138 | 3206320 | + | NZ_LR134376.1 | Aeromonas encheleia |
| 65 | 3776228 | 3776446 | + | NZ_LS483422.1 | Providencia heimbachae |
| 66 | 1351723 | 1351941 | - | NZ_CP026377.1 | Mixta gaviniae |
| 67 | 19678 | 19905 | + | NZ_CP018804.1 | Histophilus somni |
| 68 | 3227300 | 3227482 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 69 | 1342965 | 1343147 | - | NZ_CP029736.1 | Providencia rettgeri |
| 70 | 4345324 | 4345500 | - | NC_010334.1 | Shewanella halifaxensis HAW-EB4 |
| 71 | 25941 | 26159 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 72 | 20872 | 21090 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 73 | 5272586 | 5272804 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 74 | 20864 | 21082 | - | NZ_CP054254.1 | Klebsiella variicola |
| 75 | 4217550 | 4217732 | - | NC_009901.1 | Shewanella pealeana ATCC 700345 |
| 76 | 1241454 | 1241672 | - | NZ_CP008802.1 | Actinotignum schaalii |
| 77 | 66306 | 66545 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 78 | 449609 | 449827 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 79 | 528900 | 529118 | + | NZ_CP012117.1 | Dermabacter vaginalis |
| 80 | 1338191 | 1338409 | - | NZ_CP011786.1 | Bifidobacterium actinocoloniiforme DSM 22766 |
| 81 | 3264656 | 3264874 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 82 | 6398520 | 6398738 | + | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 83 | 4304151 | 4304369 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 84 | 2503943 | 2504122 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 85 | 2187600 | 2187818 | + | NZ_CP069485.1 | Corynebacterium glucuronolyticum |
| 86 | 1502084 | 1502281 | + | NZ_CP007790.1 | Corynebacterium marinum DSM 44953 |
| 87 | 1776988 | 1777206 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 88 | 3184744 | 3184926 | - | NZ_LS483470.1 | Leminorella richardii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03466.22 | 0.85 | 74 | 1351 | opposite-strand | LysR substrate binding domain |
| 2 | PF00126.29 | 0.86 | 75 | 1350 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 3 | PF00291.27 | 0.97 | 84 | 18 | same-strand | Pyridoxal-phosphate dependent enzyme |
++ More..