Result : P0A314
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Bacteriochlorophyll c-binding protein (BChl c-binding) (Chlorosome protein A) |
| NCBI Accession ID | U09866.1 |
| Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
| Left | 914 |
| Right | 1153 |
| Strand | + |
| Nucleotide Sequence | ATGAGTGGAGGAGGCGTCTTTACCGACATTTTAGCCGCCGCAGGCCGTATTTTCGAGGTTATGGTCGAAGGTCACTGGGAAACCGTCGGTATGCTTTTTGACTCGCTGGGCAAAGGCACCATGAGGATCAACCGTAATGCTTATGGTTCCATGGGTGGTGGCAGCCTTCGTGGTTCTTCCCCCGAGGTATCCGGCTATGCCGTTCCTACCAAAGAAGTTGAATCGAAGTTTGCCAAATAA |
| Sequence | MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGSSPEVSGYAVPTKEVESKFAK |
| Source of smORF | Swiss-Prot |
| Function | Component of the photosynthetic apparatus. The light harvesting B740 complex binds bacteriochlorophyll c. |
| Pubmed ID | 12093901 |
| Domain | CDD:396571 |
| Functional Category | Metal-binding |
| Uniprot ID | P0A314 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1835639 | 1835878 | - | NC_002932.3 | Chlorobaculum tepidum TLS |
| 2 | 289342 | 289581 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 3 | 2326078 | 2326317 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 4 | 270991 | 271233 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 5 | 1058989 | 1059186 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 6 | 2364868 | 2365110 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 7 | 2639599 | 2639841 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 8 | 2142880 | 2143125 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 9 | 242215 | 242466 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 10 | 2633029 | 2633274 | - | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011027.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01729.21 | 0.62 | 5 | 4722 | same-strand | Quinolinate phosphoribosyl transferase, C-terminal domain |
| 2 | PF02749.18 | 0.62 | 5 | 4722 | same-strand | Quinolinate phosphoribosyl transferase, N-terminal domain |
| 3 | PF02152.20 | 0.75 | 6 | 3941.5 | opposite-strand | Dihydroneopterin aldolase |
| 4 | PF01288.22 | 0.75 | 6 | 3424.5 | opposite-strand | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) |
| 5 | PF02374.17 | 1.0 | 8 | 1227.5 | same-strand | Anion-transporting ATPase |
| 6 | PF17886.3 | 1.0 | 8 | 1227.5 | same-strand | HSP20-like domain found in ArsA |
| 7 | PF11098.10 | 1.0 | 8 | 142.0 | same-strand | Chlorosome envelope protein C |
| 8 | PF10418.11 | 1.0 | 8 | 2171.5 | opposite-strand | Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B |
| 9 | PF00436.27 | 1.0 | 8 | 3060.0 | opposite-strand | Single-strand binding protein family |
| 10 | PF06144.15 | 0.88 | 7 | 3623 | opposite-strand | DNA polymerase III, delta subunit |
++ More..