Result : P0A243
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized 9.1 kDa protein in spaS 3'region (SPA-ORF10) (ORF-10) |
| NCBI Accession ID | D13663.1 |
| Organism | Shigella flexneri |
| Left | 7228 |
| Right | 7470 |
| Strand | + |
| Nucleotide Sequence | ATGTGTTATATGGGAGTTAATTTCTGTAATAAAATAGGTATTGATCAGTCTGAATTTGAAATAGAATCTTCCATCATTAACTCCATTGCTAATGAGGTATTGAACCCAATATCTTTCCTTAGCAATAAGGATATAATAAATGTTTTACTCAGAAAGATTTCATCTGAATGTGACCTGGTTAGAAAAGACATTTATCGTTGTGCTCTGGAGTTGGTCGTTGAAAAAACACCTGATGATTTATAA |
| Sequence | MCYMGVNFCNKIGIDQSEFEIESSIINSIANEVLNPISFLSNKDIINVLLRKISSECDLVRKDIYRCALELVVEKTPDDL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10798. Profile Description: Biofilm development protein YmgB/AriR. YmgB is part of the three gene cluster ymgABC which has a role in biofilm development and stability. YmgB represses biofilm formation in rich medium containing glucose, decreases cellular motility and also protects the cell from acid which indicates that YmgB has an important function in acid-resistance. YmgB binds as a dimer to genes which are important for biofilm formation via a ligand. Due to its important function in acid resistance it is also known as AriR (regulator of acid resistance influenced by indole). |
| Pubmed ID | 8385666 11115111 11292750 14573649 |
| Domain | CDD:402434 |
| Functional Category | Others |
| Uniprot ID | P0A243 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 135438 | 135680 | + | NC_004851.1 | Shigella flexneri 2a str. 301 |
| 2 | 2981788 | 2982036 | - | NZ_CP014007.2 | Kosakonia oryzae |
++ More..