Result : A4QI94
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | AP009044.1 |
| Organism | Corynebacterium glutamicum (strain R) |
| Left | 3256533 |
| Right | 3256715 |
| Strand | + |
| Nucleotide Sequence | ATGACGCCTGCAGGTCCAGCACAATTACTCATTGTTGCTCTTGTAGTAATTGTCCTCTTTGGTTCCAATAAGTTGCCTGATGTTGCTCGGTCCGTTGGCCGTTCGATGCGCATTTTCAAATCTGAGATCAAAGAGATGAACAAGGATCAGATCGAAAGCTCCGATCAGACCTTGAAGAACTAA |
| Sequence | MTPAGPAQLLIVALVVIVLFGSNKLPDVARSVGRSMRIFKSEIKEMNKDQIESSDQTLKN |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 17379713 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | A4QI94 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2999392 | 2999574 | + | NZ_CP015622.1 | Corynebacterium crudilactis |
| 2 | 3468023 | 3468193 | + | NZ_AP017369.1 | Corynebacterium suranareeae |
| 3 | 2768763 | 2768933 | + | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 4 | 627767 | 627916 | - | NZ_AP017457.1 | Aurantimicrobium minutum |
| 5 | 365281 | 365451 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 6 | 373491 | 373661 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 7 | 2873893 | 2874063 | + | NZ_CP036278.1 | Aeoliella mucimassa |
++ More..