Result : P0A218
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Mercuric transport protein periplasmic component (Mercury scavenger protein) (Periplasmic mercury ion-binding protein) |
| NCBI Accession ID | Y09025.1 |
| Organism | Enterobacter cloacae |
| Left | 972 |
| Right | 1247 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAACTGTTTGCCGCCCTCGCCCTCGCTGCCGTTGTTGCCCCCGTGTGGGCCGCCACCCAGACCGTCACGCTGTCCGTGCCTGGCATGACCTGCGCCTCTTGCCCGATCACTGTCAAGCACGCGCTTTCCAAGGTTGAGGGCGTGAGCAAGACCGACGTAAGTTTCGACAAGCGCCAGGCCGTCGTCACCTTCGACGATGCCAAGACCAACGTCCAGAAGTTGACCAAGGCGACCGAGGACGCGGGCTATCCGTCCAGCCTCAAACGCTGA |
| Sequence | MKKLFAALALAAVVAPVWAATQTVTLSVPGMTCASCPITVKHALSKVEGVSKTDVSFDKRQAVVTFDDAKTNVQKLTKATEDAGYPSSLKR |
| Source of smORF | Swiss-Prot |
| Function | Involved in mercury resistance. Acts as a mercury scavenger that specifically binds to a mercuric ion in the periplasm and probably passes it to the cytoplasmic mercuric reductase MerA via the mercuric transport protein MerT. {ECO:0000250|UniProtKB:P04129}. |
| Pubmed ID | 9159519 |
| Domain | CDD:412222 |
| Functional Category | Metal-binding |
| Uniprot ID | P0A218 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 63
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 52398 | 52673 | - | NZ_CP011599.1 | Phytobacter ursingii |
| 2 | 85133 | 85408 | + | NZ_CP022359.1 | Shewanella bicestrii |
| 3 | 209951 | 210226 | - | NZ_CP011601.1 | Phytobacter ursingii |
| 4 | 115477 | 115752 | - | NZ_CP061512.1 | Mixta calida |
| 5 | 150246 | 150521 | + | NZ_CP041248.1 | Raoultella electrica |
| 6 | 90416 | 90691 | - | NZ_CP041248.1 | Raoultella electrica |
| 7 | 15959 | 16234 | - | NZ_CP046027.1 | Neisseria brasiliensis |
| 8 | 1269152 | 1269427 | - | NC_007953.1 | Paraburkholderia xenovorans LB400 |
| 9 | 2758778 | 2759053 | - | NZ_CP015121.1 | Acinetobacter baumannii |
| 10 | 464984 | 465259 | - | NZ_CP059082.1 | Halomonas titanicae |
| 11 | 300363 | 300638 | - | NZ_CP029396.2 | Acinetobacter defluvii |
| 12 | 307577 | 307855 | + | NZ_CP029396.2 | Acinetobacter defluvii |
| 13 | 978517 | 978792 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 14 | 1245525 | 1245800 | + | NC_023018.2 | Pandoraea pnomenusa |
| 15 | 824624 | 824851 | - | NZ_CP028901.1 | Algicoccus marinus |
| 16 | 1789909 | 1790133 | + | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 17 | 78033 | 78266 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 18 | 380493 | 380768 | - | NZ_CP019038.1 | Massilia putida |
| 19 | 918812 | 919087 | - | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 20 | 158175 | 158450 | - | NZ_CP013125.1 | Pseudomonas mendocina S5.2 |
| 21 | 154511 | 154789 | + | NZ_CP005961.1 | Pseudomonas mandelii JR-1 |
| 22 | 316869 | 317144 | - | NZ_CP005961.1 | Pseudomonas mandelii JR-1 |
| 23 | 693694 | 693969 | - | NZ_CP035503.1 | Rhodoferax sediminis |
| 24 | 18912 | 19187 | + | NZ_CP027670.1 | Simplicispira suum |
| 25 | 940530 | 940787 | - | NZ_CP064781.1 | Azospira restricta |
| 26 | 34878 | 35153 | - | NC_008344.1 | Nitrosomonas eutropha C91 |
| 27 | 1370490 | 1370765 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 28 | 1520672 | 1520956 | - | NZ_LR134378.1 | Lautropia mirabilis |
| 29 | 71370 | 71645 | - | NZ_CP062807.1 | Cupriavidus basilensis |
| 30 | 2052 | 2327 | + | NZ_CP032520.1 | Cupriavidus oxalaticus |
| 31 | 76815 | 77090 | - | NZ_CP032520.1 | Cupriavidus oxalaticus |
| 32 | 558632 | 558907 | + | NZ_CP032520.1 | Cupriavidus oxalaticus |
| 33 | 5609404 | 5609679 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 34 | 12775 | 13050 | + | NC_016846.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 35 | 580722 | 580997 | + | NZ_CP054840.1 | Acidovorax antarcticus |
| 36 | 1969748 | 1970032 | + | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 37 | 3377555 | 3377848 | + | NZ_CP054626.1 | Cupriavidus gilardii |
| 38 | 19736 | 20014 | + | NZ_CP037953.1 | Permianibacter aggregans |
| 39 | 159115 | 159390 | + | NZ_CP011600.1 | Phytobacter ursingii |
| 40 | 325614 | 325889 | - | NZ_CP009365.1 | Pseudomonas soli |
| 41 | 5047812 | 5048090 | + | NZ_CP065748.1 | Delftia lacustris |
| 42 | 3781953 | 3782231 | - | NZ_CP017420.1 | Delftia tsuruhatensis |
| 43 | 43580 | 43855 | - | NC_008341.1 | Nitrosomonas eutropha C91 |
| 44 | 2253919 | 2254197 | - | NC_020541.1 | Rhodanobacter denitrificans |
| 45 | 2012900 | 2013178 | - | NC_020541.1 | Rhodanobacter denitrificans |
| 46 | 2229611 | 2229889 | + | NC_020541.1 | Rhodanobacter denitrificans |
| 47 | 2059136 | 2059414 | - | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 48 | 1851199 | 1851474 | + | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 49 | 5735504 | 5735782 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
| 50 | 5417410 | 5417688 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
| 51 | 1341080 | 1341355 | - | NZ_CP025120.1 | Kangiella profundi |
| 52 | 3681608 | 3681904 | - | NZ_CP048602.1 | Halomonas piezotolerans |
| 53 | 1491904 | 1492188 | + | NZ_CP021359.1 | Acidovorax carolinensis |
| 54 | 181539 | 181796 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 55 | 2476935 | 2477156 | - | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 56 | 4762739 | 4763023 | + | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 57 | 3056020 | 3056316 | - | NZ_AP022843.1 | Halomonas hydrothermalis |
| 58 | 2829527 | 2829832 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 59 | 77356 | 77652 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 60 | 1401431 | 1401691 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 61 | 1759693 | 1759938 | + | NC_006512.1 | Idiomarina loihiensis L2TR |
| 62 | 252985 | 253245 | - | NZ_CP022684.1 | Ketobacter alkanivorans |
| 63 | 1447308 | 1447598 | + | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 64 | 1369931 | 1370206 | - | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 65 | 2226640 | 2226915 | - | NZ_CP031769.1 | Salinimonas sediminis |
| 66 | 1076599 | 1076844 | + | NZ_CP031769.1 | Salinimonas sediminis |
| 67 | 291147 | 291422 | - | NZ_CP036536.1 | Salinimonas lutimaris |
| 68 | 2071886 | 2072131 | + | NC_014394.1 | Gallionella capsiferriformans ES-2 |
| 69 | 26992 | 27249 | + | NZ_CP031123.2 | Providencia huaxiensis |
| 70 | 129222 | 129464 | + | NZ_CP020932.1 | Marinobacter salarius |
| 71 | 3332922 | 3333206 | - | NZ_CP037867.1 | Hydrogenophaga pseudoflava |
| 72 | 3274160 | 3274402 | + | NZ_CP021425.1 | Oleiphilus messinensis |
| 73 | 4153362 | 4153637 | - | NC_008345.1 | Shewanella frigidimarina NCIMB 400 |
| 74 | 31053 | 31328 | - | NZ_CP061942.1 | Marinomonas algicola |
| 75 | 64503 | 64787 | - | NZ_CP011027.1 | Pseudoalteromonas arctica A 37-1-2 |
| 76 | 87681 | 87965 | + | NZ_CP033067.1 | Pseudoalteromonas agarivorans |
| 77 | 2033023 | 2033307 | + | NZ_CP011036.1 | Pseudoalteromonas nigrifaciens |
| 78 | 1708341 | 1708601 | - | NC_013960.1 | Nitrosococcus halophilus Nc 4 |
| 79 | 4599323 | 4599607 | - | NC_007951.1 | Paraburkholderia xenovorans LB400 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP046027.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13411.8 | 1.0 | 63 | 492 | opposite-strand | MerR HTH family regulatory protein |
| 2 | PF07992.16 | 0.89 | 56 | 461 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 3 | PF02852.24 | 0.89 | 56 | 461.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 4 | PF00070.29 | 0.87 | 55 | 461.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 5 | PF02411.17 | 0.97 | 61 | 16.0 | same-strand | MerT mercuric transport protein |
| 6 | PF09278.13 | 0.97 | 61 | 441.0 | opposite-strand | MerR, DNA binding |
| 7 | PF00376.25 | 1.0 | 63 | 453.0 | opposite-strand | MerR family regulatory protein |
| 8 | PF00403.28 | 0.6 | 38 | 466.5 | same-strand | Heavy-metal-associated domain |
++ More..