Protein Information |
Information Type | Description |
---|---|
Protein name | Multiple antibiotic resistance protein MarB |
NCBI Accession ID | AL513382.1 |
Organism | Salmonella typhi |
Left | 1495343 |
Right | 1495558 |
Strand | + |
Nucleotide Sequence | ATGAAAATGCTGTTTCCCGCCCTGCCGGGTCTGTTACTTATCGCCTCCGGATATGGCATTGCAGAACAAACTTTGTTACCTGTGGCGCAAAATAGCCGCGATGTGATGCTTCTGCCCTGTGTGGGCGATCCGCCAAATGACCTTCACCCCGTGAGCGTGAACAGCGATAAGTCAGATGAATTAGGCGTGCCCTATTATAACGACCAACACCTTTAA |
Sequence | MKMLFPALPGLLLIASGYGIAEQTLLPVAQNSRDVMLLPCVGDPPNDLHPVSVNSDKSDELGVPYYNDQHL |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl23980. Profile Description: MarB protein. The MarB protein is found in the multiple antibiotic resistance (mar) locus in Escherichia coli. The MarB protein is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 70 amino acids in length. There is a conserved GSDKSD sequence motif. |
Pubmed ID | 11677608 12644504 |
Domain | CDD:420130 |
Functional Category | Others |
Uniprot ID | P0A215 |
ORF Length (Amino Acid) | 71 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1596843 | 1597058 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 3993613 | 3993810 | - | NZ_CP053416.1 | Salmonella bongori |
3 | 10727 | 10945 | + | NZ_CP044098.1 | Citrobacter portucalensis |
4 | 69882 | 70100 | - | NZ_CP033744.1 | Citrobacter freundii |
5 | 1505593 | 1505811 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
6 | 2771116 | 2771322 | - | NZ_CP050508.1 | Raoultella terrigena |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07690.18 | 1.0 | 6 | 1827 | same-strand | Major Facilitator Superfamily |
2 | PF00892.22 | 1.0 | 6 | 77.0 | opposite-strand | EamA-like transporter family |
3 | PF12833.9 | 1.0 | 6 | 31.0 | same-strand | Helix-turn-helix domain |
4 | PF00165.25 | 1.0 | 6 | 31.0 | same-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
5 | PF01047.24 | 1.0 | 6 | 433.0 | same-strand | MarR family |
6 | PF12802.9 | 1.0 | 6 | 433.0 | same-strand | MarR family |
7 | PF01914.19 | 1.0 | 6 | 1125.0 | opposite-strand | MarC family integral membrane protein |
8 | PF03466.22 | 0.67 | 4 | 3200.0 | same-strand | LysR substrate binding domain |
9 | PF00126.29 | 0.67 | 4 | 3200.0 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |