ProsmORF-pred
Result : P0A1Z7
Protein Information
Information Type Description
Protein name Bacterioferritin-associated ferredoxin
NCBI Accession ID AL513382.1
Organism Salmonella typhi
Left 4231386
Right 4231580
Strand +
Nucleotide Sequence ATGTACGTTTGTTTGTGTAATGGTATAAGCGATAAAAAAATCCGCCAGGCTGTACGACAATTTCATCCACAGTCATTTCAACAGTTGCGTAAATTTATTCCTGTGGGAAATCAATGTGGTAAGTGTATTCGCGCCGCGCGAGAAGTGATGCAGGATGAGTTAACGCAAATGCCGGAATTTAAAGAGATCGCCTGA
Sequence MYVCLCNGISDKKIRQAVRQFHPQSFQQLRKFIPVGNQCGKCIRAAREVMQDELTQMPEFKEIA
Source of smORF Swiss-Prot
Function Seems to associate with BFR; could be a general redox and/or regulatory component participating in the iron storage mobilization functions of BFR. Could participate in the release or the delivery of iron from/to bacterioferritin (or other iron complexes) (By similarity). {ECO:0000250}.
Pubmed ID 11677608 12644504
Domain CDD:412737
Functional Category Metal-binding
Uniprot ID P0A1Z7
ORF Length (Amino Acid) 64
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 131
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3597930 3598124 - NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
2 4743468 4743662 + NC_013716.1 Citrobacter rodentium ICC168
3 3824383 3824577 + NZ_CP038469.1 Citrobacter tructae
4 2825995 2826189 + NZ_CP044098.1 Citrobacter portucalensis
5 2256684 2256878 - NZ_CP033744.1 Citrobacter freundii
6 1448061 1448255 - NZ_CP053416.1 Salmonella bongori
7 402153 402347 + NZ_CP035129.1 Kosakonia cowanii
8 4182299 4182493 - NZ_CP012871.1 [Enterobacter] lignolyticus
9 2699234 2699428 - NZ_CP016337.1 Kosakonia sacchari
10 4449295 4449489 - NZ_CP063425.1 Kosakonia pseudosacchari
11 3555435 3555629 + NZ_CP045300.1 Kosakonia arachidis
12 370229 370423 + NZ_CP061527.1 Shigella dysenteriae
13 3957851 3958045 - NZ_LR134340.1 Escherichia marmotae
14 2375952 2376146 - NZ_CP057657.1 Escherichia fergusonii
15 3439045 3439239 - NC_004337.2 Shigella flexneri 2a str. 301
16 4189802 4189996 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
17 4353030 4353224 - NC_009792.1 Citrobacter koseri ATCC BAA-895
18 1651276 1651470 + NZ_LT556085.1 Citrobacter amalonaticus
19 31094 31288 - NZ_CP045205.1 Citrobacter telavivensis
20 4876269 4876463 - NZ_CP015113.1 Kosakonia radicincitans
21 3430669 3430863 - NZ_AP014857.1 Escherichia albertii
22 447773 447967 + NZ_CP014007.2 Kosakonia oryzae
23 420901 421095 + NZ_CP050508.1 Raoultella terrigena
24 2999762 2999956 - NZ_CP023529.1 Lelliottia amnigena
25 717468 717662 - NZ_CP040428.1 Jejubacter calystegiae
26 4291482 4291676 - NZ_CP027986.1 Enterobacter sichuanensis
27 373567 373761 + NZ_CP054058.1 Scandinavium goeteborgense
28 540592 540786 + NZ_CP036175.1 Klebsiella huaxiensis
29 389714 389908 + NZ_AP023184.1 Buttiauxella agrestis
30 975138 975332 + NZ_CP051548.1 Phytobacter diazotrophicus
31 5136069 5136263 + NZ_CP011602.1 Phytobacter ursingii
32 2112201 2112395 + NZ_CP042941.1 Atlantibacter hermannii
33 422556 422750 + NZ_LR134475.1 Klebsiella aerogenes
34 418742 418936 + NZ_CP065838.1 Klebsiella quasipneumoniae
35 3970368 3970562 - NZ_CP012264.1 Cronobacter condimenti 1330
36 455437 455631 + NZ_CP045845.1 Kluyvera intermedia
37 419337 419531 + NZ_CP041247.1 Raoultella electrica
38 4872296 4872490 - NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
39 428279 428473 + NZ_CP054254.1 Klebsiella variicola
40 2031223 2031417 - NZ_AP019007.1 Enterobacter oligotrophicus
41 4048401 4048595 + NZ_CP045769.1 Enterobacter cancerogenus
42 307916 308110 + NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
43 4298306 4298500 - NZ_CP017184.1 Enterobacter roggenkampii
44 443562 443756 + NZ_CP013990.1 Leclercia adecarboxylata
45 4312773 4312967 - NC_015968.1 Enterobacter soli
46 3001324 3001518 + NZ_CP025034.2 Enterobacter sp. SGAir0187
47 4402321 4402515 - NZ_CP009756.1 Enterobacter cloacae
48 2860866 2861060 - NZ_CP017279.1 Enterobacter ludwigii
49 4634423 4634617 - NZ_CP043318.1 Enterobacter chengduensis
50 1258893 1259087 - NZ_CP026047.1 Raoultella planticola
51 457676 457870 + NZ_CP046672.1 Raoultella ornithinolytica
52 4205384 4205578 - NZ_AP022508.1 Enterobacter bugandensis
53 501442 501636 + NZ_CP060111.1 Klebsiella michiganensis
54 1176196 1176390 + NZ_CP020388.1 Pluralibacter gergoviae
55 220728 220922 + NZ_CP013940.1 Cronobacter malonaticus LMG 23826
56 3893014 3893208 - NZ_CP012257.1 Cronobacter universalis NCTC 9529
57 74710 74904 + NZ_CP012268.1 Cronobacter muytjensii ATCC 51329
58 4060254 4060448 - NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
59 3793473 3793667 + NZ_CP027107.1 Cronobacter sakazakii
60 230092 230286 + NZ_CP023525.1 Cedecea neteri
61 3466797 3466991 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
62 234608 234802 + NZ_LR134201.1 Cedecea lapagei
63 4013813 4014007 + NZ_CP067057.1 Rahnella aceris
64 4222647 4222841 + NZ_CP028271.1 Mixta intestinalis
65 453174 453368 + NC_017554.1 Pantoea ananatis PA13
66 4592253 4592447 - NC_014306.1 Erwinia billingiae Eb661
67 462806 463000 + NZ_CP038853.1 Pantoea vagans
68 417707 417901 + NZ_LN907827.1 Erwinia gerundensis
69 3618706 3618900 - NZ_CP034148.1 Pantoea agglomerans
70 452665 452859 + NZ_CP045720.1 Pantoea eucalypti
71 1192184 1192378 - NZ_CP019706.1 Pantoea alhagi
72 483685 483879 + NZ_CP034036.1 Brenneria nigrifluens DSM 30175 = ATCC 13028
73 473676 473870 + NZ_CP026377.1 Mixta gaviniae
74 2452619 2452813 - NZ_CP049115.1 Pantoea stewartii
75 399055 399249 + NZ_CP061511.1 Mixta calida
76 2519736 2519930 + NZ_CP011078.1 Yersinia ruckeri
77 4370220 4370414 - NZ_CP043727.1 Yersinia canariae
78 3001788 3001982 + NZ_CP009781.1 Yersinia aldovae 670-83
79 1562359 1562553 + NZ_CP054043.1 Yersinia mollaretii ATCC 43969
80 330734 330928 + NZ_CP011118.1 Yersinia enterocolitica
81 4384307 4384501 - NZ_CP032487.1 Yersinia hibernica
82 270143 270337 + NZ_FO704550.1 Xenorhabdus doucetiae
83 752554 752748 - NZ_CP023009.1 Lonsdalea britannica
84 2595983 2596177 - NZ_CP009787.1 Yersinia rohdei
85 135162 135356 + NZ_CP046293.1 Yersinia intermedia
86 516658 516852 + NZ_CP065044.1 Pectobacterium aroidearum
87 306063 306257 + NZ_LR134373.1 Yersinia pseudotuberculosis
88 1269966 1270160 - NZ_CP007230.1 Yersinia similis
89 2133832 2134026 + NZ_CP047495.1 Pectobacterium brasiliense
90 475611 475805 + NZ_CP051652.1 Pectobacterium carotovorum
91 4398371 4398565 - NZ_CP034938.1 Pectobacterium odoriferum
92 4795450 4795644 + NZ_CP014137.1 Brenneria goodwinii
93 3211176 3211370 - NZ_CP017482.1 Pectobacterium polaris
94 4731877 4732071 + NZ_CP015749.1 Pectobacterium parmentieri
95 1139560 1139754 - NZ_CP015750.1 Pectobacterium wasabiae CFBP 3304
96 4407835 4408029 - NZ_CP009125.1 Pectobacterium atrosepticum
97 4237934 4238128 - NZ_CP038498.1 Pectobacterium punjabense
98 477300 477494 + NZ_CP006569.1 Sodalis praecaptivus
99 147346 147540 + NZ_CP034035.1 Brenneria rubrifaciens
100 449468 449662 + NC_012880.1 Musicola paradisiaca Ech703
101 4429577 4429771 - NZ_CP031560.1 Dickeya dianthicola
102 1687574 1687768 - NZ_CP011104.1 Photorhabdus thracensis
103 1649409 1649603 - NZ_CP015137.1 Dickeya solani IPO 2222
104 4392702 4392896 - NC_014500.1 Dickeya dadantii 3937
105 3313227 3313421 + NZ_CP009460.1 Dickeya fangzhongdai
106 374794 374988 + NC_012912.1 Dickeya chrysanthemi Ech1591
107 5499407 5499601 - NC_005126.1 Photorhabdus laumondii subsp. laumondii TTO1
108 1320859 1321053 - NZ_CP011254.1 Serratia fonticola
109 101629 101823 + NZ_CP015581.1 Tatumella citrea
110 313626 313820 + NZ_CP065534.1 Lonsdalea populi
111 4048951 4049145 - NZ_LT615367.1 Dickeya aquatica
112 4261589 4261786 - NZ_CP050150.1 Hafnia alvei
113 471522 471716 + NZ_CP042220.2 Dickeya poaceiphila
114 4192792 4192986 - NZ_CP025799.1 Dickeya zeae
115 4879323 4879517 - NC_012962.1 Photorhabdus asymbiotica
116 4942772 4942966 - NZ_LR134494.1 Serratia quinivorans
117 4198013 4198207 - NZ_CP072455.1 Xenorhabdus budapestensis
118 3172614 3172808 - NZ_CP060401.1 Xenorhabdus nematophila
119 1121048 1121242 - NZ_CP065640.1 Serratia rubidaea
120 4898779 4898973 - NZ_CP048784.1 Serratia liquefaciens
121 5014816 5015010 - NC_015567.1 Serratia plymuthica AS9
122 1380545 1380739 + NZ_CP007044.2 Chania multitudinisentens RB-25
123 4812334 4812528 - NZ_LT906479.1 Serratia ficaria
124 334553 334747 + NZ_CP071320.1 Serratia ureilytica
125 4848038 4848232 - NZ_CP038662.1 Serratia nematodiphila
126 4068139 4068333 - NC_013892.1 Xenorhabdus bovienii SS-2004
127 4076136 4076330 - NZ_CP016948.1 Serratia surfactantfaciens
128 3492062 3492256 - NZ_FO704551.1 Xenorhabdus poinarii G6
129 4102569 4102769 - NZ_CP048796.1 Providencia vermicola
130 3166921 3167115 - NZ_CP016176.1 Xenorhabdus hominickii
131 323276 323467 + NZ_CP040449.1 Aeromonas simiae
132 300894 301085 + NZ_CP040021.1 Salinivibrio kushneri
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_003197.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00573.24 0.95 124 2363.0 same-strand Ribosomal protein L4/L1 family
2 PF00338.24 0.96 126 1380.0 same-strand Ribosomal protein S10p/S20e
3 PF00210.26 1.0 131 74.0 same-strand Ferritin-like domain
4 PF00009.29 0.98 129 1380.0 same-strand Elongation factor Tu GTP binding domain
5 PF03143.19 0.98 129 179.5 same-strand Elongation factor Tu C-terminal domain
6 PF03144.27 0.98 129 1380.0 same-strand Elongation factor Tu domain 2
7 PF01926.25 0.98 128 179 same-strand 50S ribosome-binding GTPase
8 PF03764.20 0.91 119 1432.0 same-strand Elongation factor G, domain IV
9 PF14492.8 0.91 119 1432.0 same-strand Elongation Factor G, domain III
10 PF00679.26 0.91 119 1432.0 same-strand Elongation factor G C-terminus
11 PF00177.23 0.89 117 3642.0 same-strand Ribosomal protein S7p/S5e
12 PF00164.27 0.89 116 4208 same-strand Ribosomal protein S12/S23
13 PF04077.14 0.87 114 4709.0 same-strand DsrH like protein
++ More..