Result : P0A1W0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | pyr operon leader peptide (pyrBI operon attenuator) |
| NCBI Accession ID | X05641.1 |
| Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Left | 236 |
| Right | 337 |
| Strand | + |
| Nucleotide Sequence | ATGGTTCAGTGTGTACGACATTCTGTCTTACCGCGTCTGAAAAAAGACGCAGGCCTGCCGTTTTTCTTTCCGTTGAAAACCAATACCAAGCCCCTCAATTGA |
| Sequence | MVQCVRHSVLPRLKKDAGLPFFFPLKTNTKPLN |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 3036524 11677609 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P0A1W0 |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4704959 | 4705060 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 2460890 | 2460991 | - | NZ_CP053416.1 | Salmonella bongori |
| 3 | 3295707 | 3295808 | - | NZ_CP033744.1 | Citrobacter freundii |
| 4 | 1801018 | 1801119 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 5 | 1157991 | 1158092 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 6 | 516796 | 516897 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 7 | 3501647 | 3501748 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 8 | 3428226 | 3428327 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 9 | 3000276 | 3000380 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 10 | 5407301 | 5407405 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 11 | 5436546 | 5436650 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 12 | 4122639 | 4122743 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 13 | 5053172 | 5053276 | + | NZ_CP050508.1 | Raoultella terrigena |
| 14 | 5022034 | 5022138 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 15 | 2285019 | 2285123 | - | NZ_CP026047.1 | Raoultella planticola |
| 16 | 4740587 | 4740691 | + | NZ_CP041247.1 | Raoultella electrica |
| 17 | 4651672 | 4651779 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 18 | 4294754 | 4294858 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 19 | 2217576 | 2217677 | - | NZ_CP042941.1 | Atlantibacter hermannii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP044098.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01042.23 | 1.0 | 19 | 1530 | same-strand | Endoribonuclease L-PSP |
| 2 | PF01948.20 | 1.0 | 19 | 985 | same-strand | Aspartate carbamoyltransferase regulatory chain, allosteric domain |
| 3 | PF02748.17 | 1.0 | 19 | 985 | same-strand | Aspartate carbamoyltransferase regulatory chain, metal binding domain |
| 4 | PF02729.23 | 1.0 | 19 | 52 | same-strand | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain |
| 5 | PF00185.26 | 1.0 | 19 | 52 | same-strand | Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain |
| 6 | PF04074.14 | 0.63 | 12 | 195.0 | opposite-strand | YhcH/YjgK/YiaL |
++ More..