ProsmORF-pred
Result : P0A1T5
Protein Information
Information Type Description
Protein name Fumarase D (EC 4.2.1.2)
NCBI Accession ID AL513382.1
Organism Salmonella typhi
Left 1652636
Right 1652848
Strand -
Nucleotide Sequence ATGACAAAACCGACAAAAGATGACGAACTGTACCGCGAGATGTGCCGGGTGGTGGGCAAGGTCGTGCTGGAAATGCGCGATCTGGGGCAGGAGCCTAAATATATTGTTATTGCGGGCGTGTTAAGAACCGCGCTGGCGAATCAACGCATCCAACGTAGCGCGTTAGAAAAACAGGCTATGGAAACCGTGATTAACGCTCTGGCGCGGTCATAG
Sequence MTKPTKDDELYREMCRVVGKVVLEMRDLGQEPKYIVIAGVLRTALANQRIQRSALEKQAMETVINALARS
Source of smORF Swiss-Prot
Function In vitro catalyzes the addition of water to fumarate, forming malate. Cannot catalyze the reverse reaction. Cannot use the cis-isomer maleate as substrate. {ECO:0000250|UniProtKB:P0ACX5}.
Pubmed ID 11677608 12644504
Domain CDD:420094
Functional Category Others
Uniprot ID P0A1T5
ORF Length (Amino Acid) 70
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 54
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1473811 1474023 + NC_003197.2 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
2 3867521 3867730 + NZ_CP053416.1 Salmonella bongori
3 1689592 1689801 - NZ_AP014857.1 Escherichia albertii
4 2063942 2064151 + NZ_LR134340.1 Escherichia marmotae
5 3628631 3628840 + NZ_LT556085.1 Citrobacter amalonaticus
6 1479318 1479527 + NC_013716.1 Citrobacter rodentium ICC168
7 732811 733020 + NZ_CP038469.1 Citrobacter tructae
8 1867683 1867892 + NZ_CP061527.1 Shigella dysenteriae
9 1735733 1735942 - NC_004337.2 Shigella flexneri 2a str. 301
10 1754932 1755141 - NC_000913.3 Escherichia coli str. K-12 substr. MG1655
11 2354781 2354990 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
12 1627465 1627674 - NC_009792.1 Citrobacter koseri ATCC BAA-895
13 3369568 3369777 - NZ_CP045205.1 Citrobacter telavivensis
14 4887464 4887673 + NZ_CP033744.1 Citrobacter freundii
15 403187 403396 + NZ_CP057657.1 Escherichia fergusonii
16 184779 184949 - NZ_CP044098.1 Citrobacter portucalensis
17 1986282 1986491 + NZ_CP009756.1 Enterobacter cloacae
18 1938561 1938770 + NC_015968.1 Enterobacter soli
19 1965705 1965914 + NZ_AP022508.1 Enterobacter bugandensis
20 558942 559151 - NZ_CP025034.2 Enterobacter sp. SGAir0187
21 852999 853208 + NZ_CP023529.1 Lelliottia amnigena
22 1196250 1196459 + NZ_CP017279.1 Enterobacter ludwigii
23 1477322 1477531 - NZ_CP045769.1 Enterobacter cancerogenus
24 2751817 2752026 - NZ_CP013990.1 Leclercia adecarboxylata
25 1912382 1912591 + NZ_CP017184.1 Enterobacter roggenkampii
26 2202124 2202333 + NZ_CP043318.1 Enterobacter chengduensis
27 2180085 2180297 + NZ_CP054254.1 Klebsiella variicola
28 2327 2566 + NZ_AP019007.1 Enterobacter oligotrophicus
29 4447293 4447502 + NZ_AP019007.1 Enterobacter oligotrophicus
30 1992656 1992865 + NZ_CP027986.1 Enterobacter sichuanensis
31 3012082 3012294 - NZ_LR134475.1 Klebsiella aerogenes
32 2128203 2128415 + NZ_CP065838.1 Klebsiella quasipneumoniae
33 2526559 2526771 + NZ_CP036175.1 Klebsiella huaxiensis
34 3106217 3106429 - NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
35 2759685 2759900 - NZ_LR134201.1 Cedecea lapagei
36 980194 980370 - NZ_CP045300.1 Kosakonia arachidis
37 2307397 2307612 + NZ_CP046672.1 Raoultella ornithinolytica
38 2477243 2477455 + NZ_CP060111.1 Klebsiella michiganensis
39 1999172 1999384 + NZ_CP054058.1 Scandinavium goeteborgense
40 3131120 3131296 - NZ_CP014007.2 Kosakonia oryzae
41 3002544 3002759 - NZ_CP023525.1 Cedecea neteri
42 2504104 2504316 - NZ_CP012871.1 [Enterobacter] lignolyticus
43 2053367 2053543 + NZ_CP015113.1 Kosakonia radicincitans
44 4519385 4519555 + NZ_CP015113.1 Kosakonia radicincitans
45 3685771 3685947 + NZ_CP042941.1 Atlantibacter hermannii
46 3875538 3875750 - NZ_CP020388.1 Pluralibacter gergoviae
47 2098370 2098546 + NZ_CP063425.1 Kosakonia pseudosacchari
48 2222944 2223159 + NZ_CP041247.1 Raoultella electrica
49 2162135 2162350 + NZ_CP045845.1 Kluyvera intermedia
50 4962188 4962403 - NZ_CP026047.1 Raoultella planticola
51 1027174 1027350 - NZ_CP016337.1 Kosakonia sacchari
52 1420726 1420905 + NZ_CP011602.1 Phytobacter ursingii
53 2680566 2680745 + NZ_CP051548.1 Phytobacter diazotrophicus
54 2317487 2317702 + NZ_CP050508.1 Raoultella terrigena
55 1237632 1237805 + NZ_CP046293.1 Yersinia intermedia
56 2650998 2651174 - NZ_CP035129.1 Kosakonia cowanii
57 1868515 1868694 + NZ_AP023184.1 Buttiauxella agrestis
++ More..