Protein Information |
Information Type | Description |
---|---|
Protein name | Putative ribosomal protein L7Ae-like |
NCBI Accession ID | BA000018.3 |
Organism | Staphylococcus aureus (strain N315) |
Left | 587068 |
Right | 587322 |
Strand | + |
Nucleotide Sequence | TTGTCTAAGGAAAAAGTTGCACGCTTTAACAAACAACATTTTGTAGTTGGTCTTAAAGAAACGCTTAAAGCGTTAAAGAAAGATCAAGTTACATCTTTGATTATTGCTGAAGACGTTGAAGTATATTTAATGACTCGCGTGTTAAGCCAAATCAATCAGAAAAATATACCTGTATCTTTTTTCAAAAGCAAACATGCTTTGGGTAAACATGTAGGTATTAACGTCAATGCGACAATAGTAGCATTGATTAAATGA |
Sequence | MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSFFKSKHALGKHVGINVNATIVALIK |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl00600. Profile Description: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family. This RNA binding Pelota domain is at the C-terminus of a PRTase family. These PRTase+Pelota genes are found in the biosynthetic operon associated with the Ter stress-response operon and are predicted to be involved in the biosynthesis of a ribo-nucleoside involved in stress response. |
Pubmed ID | 11418146 |
Domain | CDD:412466 |
Functional Category | Ribosomal_protein |
Uniprot ID | P0A0G4 |
ORF Length (Amino Acid) | 84 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 529608 | 529862 | + | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 549695 | 549949 | + | NZ_LR134304.1 | Staphylococcus schweitzeri |
3 | 554104 | 554358 | + | NZ_LT906460.1 | Staphylococcus simiae |
4 | 2255077 | 2255331 | - | NZ_LR134089.1 | Staphylococcus saprophyticus |
5 | 2392100 | 2392360 | - | NZ_AP018587.1 | Staphylococcus caprae |
6 | 1742421 | 1742681 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
7 | 344945 | 345199 | + | NZ_CP013114.1 | Staphylococcus equorum |
8 | 2354361 | 2354621 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
9 | 2381889 | 2382143 | - | NZ_CP008724.1 | Staphylococcus xylosus |
10 | 2261967 | 2262227 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
11 | 2254847 | 2255101 | - | NZ_CP064056.1 | Staphylococcus lloydii |
12 | 1554867 | 1555121 | - | NZ_CP018199.1 | Staphylococcus succinus |
13 | 1125948 | 1126208 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
14 | 2181990 | 2182250 | - | NZ_LR134242.1 | Staphylococcus warneri |
15 | 676294 | 676554 | - | NZ_CP033732.1 | Staphylococcus hominis |
16 | 249992 | 250252 | + | NZ_CP013911.1 | Staphylococcus haemolyticus |
17 | 1205237 | 1205497 | - | NZ_CP014022.1 | Staphylococcus lugdunensis |
18 | 384785 | 385039 | + | NZ_CP065712.1 | Staphylococcus auricularis |
19 | 2036945 | 2037199 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
20 | 2663583 | 2663837 | - | NZ_CP033460.1 | Staphylococcus debuckii |
21 | 2433932 | 2434186 | - | NZ_CP018776.1 | Staphylococcus condimenti |
22 | 2239787 | 2240041 | - | NZ_CP008747.1 | Staphylococcus hyicus |
23 | 258604 | 258858 | + | NZ_CP045927.1 | Staphylococcus agnetis |
24 | 386361 | 386615 | - | NZ_CP027770.1 | Staphylococcus felis |
25 | 254307 | 254561 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
26 | 228633 | 228887 | + | NZ_LT906464.1 | Staphylococcus muscae |
27 | 1557381 | 1557635 | + | NZ_CP020773.1 | Staphylococcus lutrae |
28 | 2240823 | 2241080 | - | NZ_CP054482.1 | Macrococcus bohemicus |
29 | 2221226 | 2221483 | - | NZ_CP047361.1 | Macrococcus canis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00466.22 | 0.83 | 24 | 8903.0 | same-strand | Ribosomal protein L10 |
2 | PF00542.21 | 0.97 | 28 | 8522.5 | same-strand | Ribosomal protein L7/L12 C-terminal domain |
3 | PF16320.7 | 0.97 | 28 | 8522.5 | same-strand | Ribosomal protein L7/L12 dimerisation domain |
4 | PF05175.16 | 0.97 | 28 | 7699.5 | same-strand | Methyltransferase small domain |
5 | PF13847.8 | 0.69 | 20 | 7677.5 | same-strand | Methyltransferase domain |
6 | PF13649.8 | 0.97 | 28 | 7699.5 | same-strand | Methyltransferase domain |
7 | PF08241.14 | 0.93 | 27 | 7699 | same-strand | Methyltransferase domain |
8 | PF08242.14 | 0.83 | 24 | 7699.5 | same-strand | Methyltransferase domain |
9 | PF00562.30 | 1.0 | 29 | 3937 | same-strand | RNA polymerase Rpb2, domain 6 |
10 | PF04561.16 | 1.0 | 29 | 3937 | same-strand | RNA polymerase Rpb2, domain 2 |
11 | PF04563.17 | 1.0 | 29 | 3937 | same-strand | RNA polymerase beta subunit |
12 | PF04565.18 | 1.0 | 29 | 3937 | same-strand | RNA polymerase Rpb2, domain 3 |
13 | PF10385.11 | 1.0 | 29 | 3937 | same-strand | RNA polymerase beta subunit external 1 domain |
14 | PF04560.22 | 1.0 | 29 | 3937 | same-strand | RNA polymerase Rpb2, domain 7 |
15 | PF04997.14 | 1.0 | 29 | 160 | same-strand | RNA polymerase Rpb1, domain 1 |
16 | PF04998.19 | 1.0 | 29 | 160 | same-strand | RNA polymerase Rpb1, domain 5 |
17 | PF04983.20 | 1.0 | 29 | 160 | same-strand | RNA polymerase Rpb1, domain 3 |
18 | PF05000.19 | 0.79 | 23 | 152 | same-strand | RNA polymerase Rpb1, domain 4 |
19 | PF00164.27 | 1.0 | 29 | 95 | same-strand | Ribosomal protein S12/S23 |
20 | PF00177.23 | 1.0 | 29 | 579 | same-strand | Ribosomal protein S7p/S5e |
21 | PF00009.29 | 1.0 | 29 | 2315.5 | same-strand | Elongation factor Tu GTP binding domain |
22 | PF03764.20 | 1.0 | 29 | 1169 | same-strand | Elongation factor G, domain IV |
23 | PF14492.8 | 1.0 | 29 | 1169 | same-strand | Elongation Factor G, domain III |
24 | PF00679.26 | 1.0 | 29 | 1169 | same-strand | Elongation factor G C-terminus |
25 | PF03144.27 | 1.0 | 29 | 2315.5 | same-strand | Elongation factor Tu domain 2 |
26 | PF01926.25 | 1.0 | 29 | 2315.5 | same-strand | 50S ribosome-binding GTPase |
27 | PF03143.19 | 1.0 | 29 | 3465 | same-strand | Elongation factor Tu C-terminal domain |
28 | PF01546.30 | 0.79 | 23 | 4865 | opposite-strand | Peptidase family M20/M25/M40 |
29 | PF07687.16 | 0.66 | 19 | 4865 | opposite-strand | Peptidase dimerisation domain |