Protein Information |
Information Type | Description |
---|---|
Protein name | Light-harvesting protein B-808/866 beta chain (Antenna pigment protein beta chain) (Bacteriochlorophyll a-binding protein) |
NCBI Accession ID | X73899.1 |
Organism | Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) |
Left | 198 |
Right | 359 |
Strand | + |
Nucleotide Sequence | ATGCGCGACGACGATGATCTGGTTCCACCAAAATGGCGTCCGCTGTTTAACAACCAGGACTGGCTGCTGCACGACATCGTGGTGAAGTCGTTCTACGGCTTTGGTGTCATTGCAGCCATTGCCCACCTGCTGGTCTATCTCTGGAAACCGTGGCTTCCCTAG |
Sequence | MRDDDDLVPPKWRPLFNNQDWLLHDIVVKSFYGFGVIAAIAHLLVYLWKPWLP |
Source of smORF | Swiss-Prot |
Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
Pubmed ID | 7535995 21714912 |
Domain | CDD:395441 |
Functional Category | Metal-binding |
Uniprot ID | P09927 |
ORF Length (Amino Acid) | 53 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3224052 | 3224213 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
2 | 4926835 | 4926975 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01040.20 | 1.0 | 2 | 2698.0 | same-strand | UbiA prenyltransferase family |