Result : P09927
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Light-harvesting protein B-808/866 beta chain (Antenna pigment protein beta chain) (Bacteriochlorophyll a-binding protein) |
| NCBI Accession ID | X73899.1 |
| Organism | Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) |
| Left | 198 |
| Right | 359 |
| Strand | + |
| Nucleotide Sequence | ATGCGCGACGACGATGATCTGGTTCCACCAAAATGGCGTCCGCTGTTTAACAACCAGGACTGGCTGCTGCACGACATCGTGGTGAAGTCGTTCTACGGCTTTGGTGTCATTGCAGCCATTGCCCACCTGCTGGTCTATCTCTGGAAACCGTGGCTTCCCTAG |
| Sequence | MRDDDDLVPPKWRPLFNNQDWLLHDIVVKSFYGFGVIAAIAHLLVYLWKPWLP |
| Source of smORF | Swiss-Prot |
| Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
| Pubmed ID | 7535995 21714912 |
| Domain | CDD:395441 |
| Functional Category | Metal-binding |
| Uniprot ID | P09927 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3224052 | 3224213 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 2 | 4926835 | 4926975 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011831.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01040.20 | 1.0 | 2 | 2698.0 | same-strand | UbiA prenyltransferase family |
++ More..