Result : P09881
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Colicin-E8 immunity protein (ImmE8) (Microcin-E8 immunity protein) |
| NCBI Accession ID | M21404.1 |
| Organism | Escherichia coli |
| Left | 623 |
| Right | 880 |
| Strand | + |
| Nucleotide Sequence | ATGGAACTGAAAAACAGCATTAGTGATTACACTGAAACTGAATTCAAAAAAATTATTGAAGACATCATCAATTGTGAAGGTGATGAAAAAAAACAGGATGATAACCTCGAGCATTTTATAAGTGTTACTGAGCATCCTAGTGGTTCTGATCTGATTTATTACCCAGAAGGTAATAATGATGGTAGCCCTGAAGCTGTTATTAAAGAGATTAAAGAATGGCGAGCTGCTAACGGTAAGTCAGGATTTAAACAGGGCTGA |
| Sequence | MELKNSISDYTETEFKKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQG |
| Source of smORF | Swiss-Prot |
| Function | This protein is able to protect a cell, which harbors the plasmid ColE8 encoding colicin E8, against colicin E8, it binds specifically to the DNase-type colicin and inhibits its bactericidal activity. |
| Pubmed ID | 3323826 3290201 |
| Domain | CDD:413614 |
| Functional Category | Others |
| Uniprot ID | P09881 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2016930 | 2017187 | + | NZ_LS483422.1 | Providencia heimbachae |
| 2 | 1393742 | 1393996 | + | NC_012962.1 | Photorhabdus asymbiotica |
| 3 | 4225394 | 4225654 | - | NZ_CP029736.1 | Providencia rettgeri |
| 4 | 2081464 | 2081748 | - | NZ_CP062158.2 | Pseudomonas lundensis |
| 5 | 4163560 | 4163820 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 6 | 1475865 | 1476095 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 7 | 4389673 | 4389933 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 8 | 2012813 | 2013055 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 9 | 3299129 | 3299395 | + | NZ_CP014262.1 | Pseudomonas corrugata |
| 10 | 4505008 | 4505262 | - | NZ_CP046293.1 | Yersinia intermedia |
| 11 | 5300297 | 5300545 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 12 | 1490188 | 1490430 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 13 | 2865528 | 2865734 | - | NZ_CP065640.1 | Serratia rubidaea |
| 14 | 2487150 | 2487356 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 15 | 2486885 | 2487145 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 16 | 4519274 | 4519531 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 17 | 5104 | 5310 | + | NC_010693.1 | Erwinia tasmaniensis Et1/99 |
| 18 | 1806263 | 1806517 | + | NZ_CP007230.1 | Yersinia similis |
| 19 | 4393467 | 4393721 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 20 | 2197515 | 2197775 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 21 | 601839 | 602099 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 22 | 4501632 | 4501886 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 23 | 2718014 | 2718229 | + | NZ_CP014205.2 | Pseudomonas glycinae |
| 24 | 2992239 | 2992493 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 25 | 2248062 | 2248316 | - | NZ_CP048784.1 | Serratia liquefaciens |
| 26 | 5526366 | 5526575 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 27 | 2796920 | 2797180 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_012962.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06958.14 | 0.67 | 16 | 44.0 | same-strand | S-type Pyocin |
++ More..