Result : P09427

Protein Information

• Protein name: Protein NifT
• NCBI Accession ID: M20568.1
• Organism: Azotobacter vinelandii
• Left: 5520
• Right: 5738
• Strand: +
• Nucleotide Sequence: ATGCCCAGCGTCATGATTCGCCGCAACGACGAAGGCCAACTGACCTTCTATATCGCCAAGAAAGACCAGGAAGAGATCGTGGTGTCCCTGGAGCATGACAGCCCCGAACTCTGGGGTGGCGAAGTCACCCTCGGCGACGGTTCGACCTATTTCATCGAGCCGATACCGCAACCCAAGCTGCCGATCACCGTGCGCGCCAAGCGAGCCGGCGAGGCCTGA
• Sequence: MPSVMIRRNDEGQLTFYIAKKDQEEIVVSLEHDSPELWGGEVTLGDGSTYFIEPIPQPKLPITVRAKRAGEA
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl02351. Profile Description: NifT/FixU protein. This largely uncharacterized protein family is assigned a role in nitrogen fixation by two criteria. First, its gene occurs, generally, among genes essential for expression of active nitrogenase. Second, its phylogenetic profile closely matches that of nitrogen-fixing bacteria. However, mutational studies in Klebsiella pneumoniae failed to demonstrate any phenotype for deletion or overexpression of the protein.
• Pubmed ID: 2644218 3863780
• Domain: CDD:413286
• Functional Category: Others
• Uniprot ID: P09427
• ORF Length (Amino Acid): 72

Conservation Analysis

No. of Species: 26

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	141040	141258	+	NC_012560.1	Azotobacter vinelandii DJ
2	148284	148502	+	NZ_CP011835.1	Azotobacter chroococcum
3	2563913	2564131	-	NZ_CP045302.1	Azotobacter salinestris
4	2501043	2501267	-	NZ_CP060084.1	Teredinibacter haidensis
5	3841335	3841547	+	NZ_CP035467.1	Methylotuvimicrobium buryatense
6	3551308	3551520	-	NC_019940.1	Thioflavicoccus mobilis 8321
7	887146	887370	+	NZ_CP012373.2	Beggiatoa leptomitoformis
8	1605721	1605933	+	NC_015572.1	Methylomonas methanica MC09
9	1357042	1357260	+	NZ_CP014476.1	Methylomonas denitrificans
10	1027043	1027264	+	NZ_CP043929.1	Methylomonas rhizoryzae
11	1879585	1879809	+	NZ_CP007142.1	Gynuella sunshinyii YC6258
12	2156035	2156253	-	NC_013851.1	Allochromatium vinosum DSM 180
13	1933247	1933456	-	NZ_AP018724.1	Sulfurivermis fontis
14	3613271	3613483	+	NZ_CP011412.1	Sedimenticola thiotaurini
15	3981384	3981602	+	NC_018012.1	Thiocystis violascens DSM 198
16	674653	674871	+	NZ_CP007031.1	Marichromatium purpuratum 984
17	3404329	3404541	+	NZ_CP010803.1	Martelella endophytica
18	975923	976141	+	NZ_CP009978.1	Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759
19	1318704	1318925	+	NZ_CP047475.1	Vibrio astriarenae
20	1966817	1967029	-	NZ_CP072793.1	Thiothrix unzii
21	567545	567763	+	NZ_AP014636.1	Vibrio tritonius
22	740498	740710	+	NC_012691.1	Tolumonas auensis DSM 9187
23	1494325	1494543	-	NC_008576.1	Magnetococcus marinus MC-1
24	1012798	1013010	+	NC_014762.1	Sulfuricurvum kujiense DSM 16994
25	583346	583558	+	NZ_CP016210.1	Azoarcus olearius
26	5839209	5839385	+	NZ_AP017928.1	Methylocaldum marinum

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_012560.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00142.20	0.92	24	3397.0	same-strand	4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family
2	PF01656.25	0.92	24	3397.0	same-strand	CobQ/CobB/MinD/ParA nucleotide binding domain
3	PF00148.21	0.92	24	1762	same-strand	Nitrogenase component 1 type Oxidoreductase
4	PF11844.10	0.92	24	99.0	same-strand	Domain of unknown function (DUF3364)
5	PF02579.19	0.77	20	231.5	same-strand	Dinitrogenase iron-molybdenum cofactor
6	PF19624.1	0.77	20	846.5	same-strand	Family of unknown function (DUF6129)