Protein Information |
Information Type | Description |
---|---|
Protein name | Protein NifT |
NCBI Accession ID | M20568.1 |
Organism | Azotobacter vinelandii |
Left | 5520 |
Right | 5738 |
Strand | + |
Nucleotide Sequence | ATGCCCAGCGTCATGATTCGCCGCAACGACGAAGGCCAACTGACCTTCTATATCGCCAAGAAAGACCAGGAAGAGATCGTGGTGTCCCTGGAGCATGACAGCCCCGAACTCTGGGGTGGCGAAGTCACCCTCGGCGACGGTTCGACCTATTTCATCGAGCCGATACCGCAACCCAAGCTGCCGATCACCGTGCGCGCCAAGCGAGCCGGCGAGGCCTGA |
Sequence | MPSVMIRRNDEGQLTFYIAKKDQEEIVVSLEHDSPELWGGEVTLGDGSTYFIEPIPQPKLPITVRAKRAGEA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl02351. Profile Description: NifT/FixU protein. This largely uncharacterized protein family is assigned a role in nitrogen fixation by two criteria. First, its gene occurs, generally, among genes essential for expression of active nitrogenase. Second, its phylogenetic profile closely matches that of nitrogen-fixing bacteria. However, mutational studies in Klebsiella pneumoniae failed to demonstrate any phenotype for deletion or overexpression of the protein. |
Pubmed ID | 2644218 3863780 |
Domain | CDD:413286 |
Functional Category | Others |
Uniprot ID | P09427 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 141040 | 141258 | + | NC_012560.1 | Azotobacter vinelandii DJ |
2 | 148284 | 148502 | + | NZ_CP011835.1 | Azotobacter chroococcum |
3 | 2563913 | 2564131 | - | NZ_CP045302.1 | Azotobacter salinestris |
4 | 2501043 | 2501267 | - | NZ_CP060084.1 | Teredinibacter haidensis |
5 | 3841335 | 3841547 | + | NZ_CP035467.1 | Methylotuvimicrobium buryatense |
6 | 3551308 | 3551520 | - | NC_019940.1 | Thioflavicoccus mobilis 8321 |
7 | 887146 | 887370 | + | NZ_CP012373.2 | Beggiatoa leptomitoformis |
8 | 1605721 | 1605933 | + | NC_015572.1 | Methylomonas methanica MC09 |
9 | 1357042 | 1357260 | + | NZ_CP014476.1 | Methylomonas denitrificans |
10 | 1027043 | 1027264 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
11 | 1879585 | 1879809 | + | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
12 | 2156035 | 2156253 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
13 | 1933247 | 1933456 | - | NZ_AP018724.1 | Sulfurivermis fontis |
14 | 3613271 | 3613483 | + | NZ_CP011412.1 | Sedimenticola thiotaurini |
15 | 3981384 | 3981602 | + | NC_018012.1 | Thiocystis violascens DSM 198 |
16 | 674653 | 674871 | + | NZ_CP007031.1 | Marichromatium purpuratum 984 |
17 | 3404329 | 3404541 | + | NZ_CP010803.1 | Martelella endophytica |
18 | 975923 | 976141 | + | NZ_CP009978.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
19 | 1318704 | 1318925 | + | NZ_CP047475.1 | Vibrio astriarenae |
20 | 1966817 | 1967029 | - | NZ_CP072793.1 | Thiothrix unzii |
21 | 567545 | 567763 | + | NZ_AP014636.1 | Vibrio tritonius |
22 | 740498 | 740710 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
23 | 1494325 | 1494543 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
24 | 1012798 | 1013010 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
25 | 583346 | 583558 | + | NZ_CP016210.1 | Azoarcus olearius |
26 | 5839209 | 5839385 | + | NZ_AP017928.1 | Methylocaldum marinum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00142.20 | 0.92 | 24 | 3397.0 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
2 | PF01656.25 | 0.92 | 24 | 3397.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
3 | PF00148.21 | 0.92 | 24 | 1762 | same-strand | Nitrogenase component 1 type Oxidoreductase |
4 | PF11844.10 | 0.92 | 24 | 99.0 | same-strand | Domain of unknown function (DUF3364) |
5 | PF02579.19 | 0.77 | 20 | 231.5 | same-strand | Dinitrogenase iron-molybdenum cofactor |
6 | PF19624.1 | 0.77 | 20 | 846.5 | same-strand | Family of unknown function (DUF6129) |