Result : A4J774
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | CP000612.1 |
| Organism | Desulfotomaculum reducens (strain MI-1) |
| Left | 2634902 |
| Right | 2635144 |
| Strand | + |
| Nucleotide Sequence | ATGTTAATCCTATCCAGAAAAAAGAATGAGTCTATACATATCGGTGACAATATCATCATCACCGTGGTGGATATTGGCGGGGATAACATTAAAATTGGTATCGATGCCCCCAAAAATGTCCAAATTTTTCGTAGTGAACTATTAAAGGCCGTTGAACAGGAAAATAAAAATGCTGTCTCCTCCAAGTCGGTAATTCAAGATTTGGCTCAATTAATTAAAGGTGACGAAAAAAAACAAACGTAA |
| Sequence | MLILSRKKNESIHIGDNIIITVVDIGGDNIKIGIDAPKNVQIFRSELLKAVEQENKNAVSSKSVIQDLAQLIKGDEKKQT |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | A4J774 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 48
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2634902 | 2635144 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 2 | 2558080 | 2558319 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 3 | 903031 | 903258 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 4 | 1571353 | 1571586 | - | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 5 | 689959 | 690198 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 6 | 1262159 | 1262404 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 7 | 2273478 | 2273708 | - | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 8 | 2784134 | 2784385 | - | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 9 | 1498786 | 1499004 | - | NC_015385.1 | Treponema succinifaciens DSM 2489 |
| 10 | 3189801 | 3190037 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 11 | 86707 | 86946 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
| 12 | 4439851 | 4440084 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 13 | 114616 | 114834 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 14 | 3067624 | 3067863 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 15 | 281384 | 281605 | + | NZ_CP025197.1 | Acetivibrio saccincola |
| 16 | 4735732 | 4735947 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 17 | 3906917 | 3907126 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 18 | 1575912 | 1576139 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 19 | 1287272 | 1287484 | + | NC_015174.1 | Rubinisphaera brasiliensis DSM 5305 |
| 20 | 484031 | 484261 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 21 | 619047 | 619265 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 22 | 4090861 | 4091094 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 23 | 1959539 | 1959760 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 24 | 6594967 | 6595200 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 25 | 3436208 | 3436435 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 26 | 277606 | 277836 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 27 | 5105048 | 5105281 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 28 | 2140105 | 2140323 | + | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 29 | 1762755 | 1762991 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 30 | 117235 | 117462 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 31 | 570544 | 570789 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 32 | 138158 | 138406 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 33 | 1015008 | 1015235 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 34 | 1052429 | 1052656 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 35 | 1106481 | 1106708 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 36 | 203711 | 203932 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 37 | 2334544 | 2334777 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 38 | 1909569 | 1909784 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 39 | 1288376 | 1288603 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 40 | 1827592 | 1827837 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 41 | 975867 | 976094 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 42 | 200237 | 200458 | + | NZ_CP016538.2 | Planococcus maritimus |
| 43 | 3391145 | 3391366 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 44 | 200091 | 200312 | + | NZ_CP059540.1 | Planococcus maritimus |
| 45 | 992230 | 992457 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 46 | 3910128 | 3910355 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 47 | 2142768 | 2143001 | - | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 48 | 760582 | 760809 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 49 | 262435 | 262656 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP019698.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02623.17 | 0.77 | 37 | 2.0 | same-strand | FliW protein |
| 2 | PF00669.22 | 0.71 | 34 | 608.0 | same-strand | Bacterial flagellin N-terminal helical region |
++ More..