Result : A0A2K4Z9G8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cortex morphogenetic protein A |
| NCBI Accession ID | AL009126.3 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 527912 |
| Right | 528025 |
| Strand | - |
| Nucleotide Sequence | ATGCCAAATTGGCTTAAAAAGCAGATGCAAAAAGCGTTCCTTGAAAAAGATAATTACCAAATTAAACTGCTGAATCAATGCTGGTATTTCTATAGGAAAAAACACTGCTCGTAA |
| Sequence | MPNWLKKQMQKAFLEKDNYQIKLLNQCWYFYRKKHCS |
| Source of smORF | Swiss-Prot |
| Function | Ensures proper spore envelope assembly (Pubmed:22463703, Pubmed:26387458). Represses premature cortex assembly until coat assembly successfully initiates (Pubmed:22463703). Also participates in a quality-control pathway that selectively removes defective sporulating cells through regulated cell death. Acts as an adaptator that delivers SpoIVA to the ClpXP proteolytic machinery for degradation, specifically in cells that improperly assemble the spore envelope (Pubmed:26387458). {ECO:0000269|Pubmed:22463703, ECO:0000269|Pubmed:26387458}. |
| Pubmed ID | 9384377 29280348 22463703 26387458 |
| Domain | CDD:380221 |
| Functional Category | Others |
| Uniprot ID | A0A2K4Z9G8 |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 60
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 526449 | 526562 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 2 | 527912 | 528025 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 1481660 | 1481773 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 479689 | 479802 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 524874 | 524987 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 6 | 503752 | 503865 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 7 | 682670 | 682783 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 8 | 516872 | 516985 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 9 | 3433217 | 3433330 | + | NZ_CP011937.1 | Bacillus velezensis |
| 10 | 613206 | 613316 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 629107 | 629217 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 12 | 571468 | 571578 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 1562363 | 1562482 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 14 | 637217 | 637330 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 15 | 1408227 | 1408340 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 16 | 624719 | 624832 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 17 | 62778 | 62891 | - | NZ_CP015440.1 | Anoxybacillus amylolyticus |
| 18 | 897819 | 897932 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 19 | 265856 | 265969 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 20 | 3403927 | 3404040 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 21 | 259195 | 259308 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 22 | 743908 | 744018 | - | NZ_LS483476.1 | Lederbergia lentus |
| 23 | 1385138 | 1385251 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 24 | 3003004 | 3003117 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 25 | 198176 | 198289 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 26 | 2673216 | 2673329 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 27 | 45198 | 45311 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 28 | 2931370 | 2931483 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 29 | 246988 | 247101 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 30 | 2511121 | 2511240 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 31 | 3940042 | 3940155 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 32 | 247347 | 247463 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 33 | 244124 | 244240 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 34 | 3872568 | 3872678 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 35 | 226814 | 226936 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 36 | 242627 | 242743 | - | NC_011725.1 | Bacillus cereus B4264 |
| 37 | 241237 | 241353 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 38 | 4875621 | 4875734 | + | NZ_CP040336.1 | Bacillus luti |
| 39 | 2280709 | 2280828 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 40 | 2744317 | 2744436 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 41 | 549824 | 549940 | - | NZ_CP053989.1 | Niallia circulans |
| 42 | 453641 | 453760 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 43 | 3957621 | 3957728 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 44 | 208542 | 208658 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 45 | 254792 | 254920 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 46 | 405529 | 405639 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 47 | 450147 | 450263 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 48 | 2554249 | 2554374 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 49 | 355299 | 355421 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 50 | 5322507 | 5322629 | + | NZ_CP026363.1 | Brevibacillus agri |
| 51 | 3163272 | 3163394 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 52 | 250468 | 250584 | - | NZ_CP034118.1 | Staphylospora marina |
| 53 | 3256160 | 3256282 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 54 | 1505916 | 1506032 | - | NZ_CP009288.1 | Paenibacillus durus |
| 55 | 1292784 | 1292900 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 56 | 1919199 | 1919315 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 57 | 4076443 | 4076562 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 58 | 84868 | 84987 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 59 | 83688 | 83807 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 60 | 485234 | 485341 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051464.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09371.12 | 0.92 | 55 | 48 | opposite-strand | Tex-like protein N-terminal domain |
| 2 | PF16921.7 | 0.92 | 55 | 48 | opposite-strand | Tex protein YqgF-like domain |
| 3 | PF12836.9 | 0.92 | 55 | 48 | opposite-strand | Helix-hairpin-helix motif |
| 4 | PF17674.3 | 0.92 | 55 | 48 | opposite-strand | HHH domain |
| 5 | PF00575.25 | 0.95 | 57 | 50 | opposite-strand | S1 RNA binding domain |
| 6 | PF14635.8 | 0.92 | 55 | 48 | opposite-strand | Helix-hairpin-helix motif |
| 7 | PF10263.11 | 0.8 | 48 | 104.0 | opposite-strand | SprT-like family |
| 8 | PF17283.4 | 0.95 | 57 | 104 | opposite-strand | SprT-like zinc ribbon domain |
++ More..