Protein Information |
Information Type | Description |
---|---|
Protein name | Nitrogenase-stabilizing/protective protein NifW |
NCBI Accession ID | X13303.1 |
Organism | Klebsiella pneumoniae |
Left | 16031 |
Right | 16291 |
Strand | + |
Nucleotide Sequence | ATGATGGAGTGGTTTTATCAAATTCCCGGCGTGGACGAACTTCGCTCCGCCGAATCTTTTTTTCAGTTTTTCGCCGTCCCCTATCAGCCCGAGCTGCTTGGCCGCTGCAGCCTGCCGGTGCTGGCAACGTTTCATCGCAAACTCCGCGCGGAGGTGCCGCTGCAAAACCGGCTCGAGGATAACGACCGCGCGCCCTGGCTGCTGGCGCGAAGACTGCTCGCGGAGAGCTATCAGCAACAGTTTCAGGAGAGCGGAACATGA |
Sequence | MMEWFYQIPGVDELRSAESFFQFFAVPYQPELLGRCSLPVLATFHRKLRAEVPLQNRLEDNDRAPWLLARRLLAESYQQQFQESGT |
Source of smORF | Swiss-Prot |
Function | May protect the nitrogenase Fe-Mo protein from oxidative damage. {ECO:0000250}. |
Pubmed ID | 3062178 3054814 |
Domain | |
Functional Category | Others |
Uniprot ID | P09137 |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1993225 | 1993485 | - | NZ_CP060111.1 | Klebsiella michiganensis |
2 | 3409661 | 3409921 | + | NZ_CP041247.1 | Raoultella electrica |
3 | 2815711 | 2815941 | - | NZ_CP050508.1 | Raoultella terrigena |
4 | 1779225 | 1779482 | - | NZ_CP054254.1 | Klebsiella variicola |
5 | 1727765 | 1728022 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
6 | 771122 | 771352 | + | NZ_CP045300.1 | Kosakonia arachidis |
7 | 2842540 | 2842797 | + | NZ_CP014007.2 | Kosakonia oryzae |
8 | 2322652 | 2322909 | - | NZ_CP015113.1 | Kosakonia radicincitans |
9 | 2309399 | 2309656 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
10 | 808620 | 808877 | + | NZ_CP016337.1 | Kosakonia sacchari |
11 | 1750950 | 1751207 | - | NZ_CP011602.1 | Phytobacter ursingii |
12 | 3296578 | 3296835 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
13 | 1960259 | 1960516 | - | NZ_CP017482.1 | Pectobacterium polaris |
14 | 3205617 | 3205874 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
15 | 566571 | 566828 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
16 | 4304578 | 4304847 | - | NC_014500.1 | Dickeya dadantii 3937 |
17 | 1480869 | 1481138 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
18 | 3427771 | 3428040 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
19 | 4317610 | 4317879 | - | NZ_CP031560.1 | Dickeya dianthicola |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00158.28 | 0.74 | 14 | 3657.5 | same-strand | Sigma-54 interaction domain |
2 | PF14532.8 | 0.74 | 14 | 3657.5 | same-strand | Sigma-54 interaction domain |
3 | PF02954.21 | 0.74 | 14 | 3657.5 | same-strand | Bacterial regulatory protein, Fis family |
4 | PF13185.8 | 0.74 | 14 | 3657.5 | same-strand | GAF domain |
5 | PF01590.28 | 0.74 | 14 | 3657.5 | same-strand | GAF domain |
6 | PF07728.16 | 0.74 | 14 | 3657.5 | same-strand | AAA domain (dynein-related subfamily) |
7 | PF00004.31 | 0.74 | 14 | 3657.5 | same-strand | ATPase family associated with various cellular activities (AAA) |
8 | PF00989.27 | 0.84 | 16 | 2212.5 | same-strand | PAS fold |
9 | PF13426.9 | 0.84 | 16 | 2212.5 | same-strand | PAS domain |
10 | PF08448.12 | 0.84 | 16 | 2212.5 | same-strand | PAS fold |
11 | PF08447.14 | 0.84 | 16 | 2212.5 | same-strand | PAS fold |
12 | PF00258.27 | 0.89 | 17 | 1324 | opposite-strand | Flavodoxin |
13 | PF00639.23 | 1.0 | 19 | 437 | same-strand | PPIC-type PPIASE domain |
14 | PF13616.8 | 1.0 | 19 | 437 | same-strand | PPIC-type PPIASE domain |
15 | PF13145.8 | 1.0 | 19 | 437 | same-strand | PPIC-type PPIASE domain |
16 | PF04319.15 | 1.0 | 19 | -3 | same-strand | NifZ domain |
17 | PF00682.21 | 1.0 | 19 | 3 | same-strand | HMGL-like |
18 | PF00266.21 | 1.0 | 19 | 1159 | same-strand | Aminotransferase class-V |
19 | PF01592.18 | 1.0 | 19 | 2395 | same-strand | NifU-like N terminal domain |
20 | PF04324.17 | 1.0 | 19 | 2395 | same-strand | BFD-like [2Fe-2S] binding domain |
21 | PF01106.19 | 1.0 | 19 | 2395 | same-strand | NifU-like domain |
22 | PF02579.19 | 0.84 | 16 | 3419.5 | same-strand | Dinitrogenase iron-molybdenum cofactor |
23 | PF00148.21 | 0.79 | 15 | 3870 | same-strand | Nitrogenase component 1 type Oxidoreductase |