Result : P09134
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein NifT |
| NCBI Accession ID | X13303.1 |
| Organism | Klebsiella pneumoniae |
| Left | 8182 |
| Right | 8400 |
| Strand | + |
| Nucleotide Sequence | ATGCCCATCGTGATTTTCCGTGAGCGCGGCGCGGACCTGTACGCCTATATCGCGAAACAGGATCTGGAAGCGCGAGTGATCCAGATTGAGCATAACGACGCTGAACGCTGGGGCGGCGCGATTTCGCTGGAGGGGGGACGCCGCTACTACGTGCATCCGCAGCCGGGGCGTCCCGTCTTTCCGATAAGCCTGCGCGCGACGCGCAATACCTTGATATAA |
| Sequence | MPIVIFRERGADLYAYIAKQDLEARVIQIEHNDAERWGGAISLEGGRRYYVHPQPGRPVFPISLRATRNTLI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02351. Profile Description: NifT/FixU protein. This largely uncharacterized protein family is assigned a role in nitrogen fixation by two criteria. First, its gene occurs, generally, among genes essential for expression of active nitrogenase. Second, its phylogenetic profile closely matches that of nitrogen-fixing bacteria. However, mutational studies in Klebsiella pneumoniae failed to demonstrate any phenotype for deletion or overexpression of the protein. |
| Pubmed ID | 3062178 3054814 3043382 3322261 |
| Domain | CDD:413286 |
| Functional Category | Others |
| Uniprot ID | P09134 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 20
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3395722 | 3395940 | + | NZ_CP041247.1 | Raoultella electrica |
| 2 | 2001115 | 2001333 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 3 | 1736179 | 1736397 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 4 | 1787376 | 1787594 | - | NZ_CP054254.1 | Klebsiella variicola |
| 5 | 2823474 | 2823692 | - | NZ_CP050508.1 | Raoultella terrigena |
| 6 | 761656 | 761874 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 7 | 2834854 | 2835072 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 8 | 2330378 | 2330596 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 9 | 800954 | 801172 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 10 | 2317115 | 2317333 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 11 | 3288874 | 3289092 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 12 | 1758691 | 1758909 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 13 | 1968032 | 1968250 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 14 | 3215786 | 3216004 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 15 | 88219 | 88434 | - | NZ_CP067058.1 | Rahnella aceris |
| 16 | 553531 | 553749 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 17 | 1492170 | 1492388 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 18 | 3413883 | 3414101 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 19 | 4318361 | 4318579 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 20 | 4329052 | 4329270 | - | NZ_CP031560.1 | Dickeya dianthicola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP041247.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01855.21 | 0.95 | 19 | 4410 | opposite-strand | Pyruvate flavodoxin/ferredoxin oxidoreductase, thiamine diP-bdg |
| 2 | PF01558.20 | 0.95 | 19 | 4410 | opposite-strand | Pyruvate ferredoxin/flavodoxin oxidoreductase |
| 3 | PF10371.11 | 0.95 | 19 | 4410 | opposite-strand | Domain of unknown function |
| 4 | PF17147.6 | 0.95 | 19 | 4410 | opposite-strand | Pyruvate:ferredoxin oxidoreductase core domain II |
| 5 | PF12838.9 | 0.95 | 19 | 4410 | opposite-strand | 4Fe-4S dicluster domain |
| 6 | PF13484.8 | 0.95 | 19 | 4410 | opposite-strand | 4Fe-4S double cluster binding domain |
| 7 | PF00037.29 | 0.95 | 19 | 4410 | opposite-strand | 4Fe-4S binding domain |
| 8 | PF12837.9 | 0.7 | 14 | 4494.0 | opposite-strand | 4Fe-4S binding domain |
| 9 | PF13237.8 | 0.95 | 19 | 4410 | opposite-strand | 4Fe-4S dicluster domain |
| 10 | PF13187.8 | 0.95 | 19 | 4410 | opposite-strand | 4Fe-4S dicluster domain |
| 11 | PF00142.20 | 1.0 | 20 | 3135.5 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
| 12 | PF01656.25 | 1.0 | 20 | 3135.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 13 | PF00148.21 | 1.0 | 20 | 1658.0 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 14 | PF11844.10 | 1.0 | 20 | 42.5 | same-strand | Domain of unknown function (DUF3364) |
| 15 | PF02579.19 | 1.0 | 20 | 13.5 | same-strand | Dinitrogenase iron-molybdenum cofactor |
++ More..