Result : P08868
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YuaZ |
| NCBI Accession ID | AP001918.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 52569 |
| Right | 52841 |
| Strand | + |
| Nucleotide Sequence | GTGCGGTTGTATGCCTGCTGTGGATTGCTGCTGTGTCCTGCTTATCCACAACATTTTGCGCACGGTTATGTGGACAAAATACCTGGTTACCCAGGCCGTGCCGGCACGTTAACCGGGCTGCATCCGATGCAAGTGTGTCGCTGTCGACGGCCTCCTCACCCGGTCACGTTTCGTCGTTTCTCCTCCACGCGCTGCGGCTTCGGGGCCGCACCTGCATTCGTATGCGGTCGCCCGGTTACAGGTGCGGCACGGCCTGATGGAGGCCGCATGTGA |
| Sequence | MRLYACCGLLLCPAYPQHFAHGYVDKIPGYPGRAGTLTGLHPMQVCRCRRPPHPVTFRRFSSTRCGFGAAPAFVCGRPVTGAARPDGGRM |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 3029390 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P08868 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 35359 | 35631 | + | NC_002128.1 | Escherichia coli O157:H7 str. Sakai |
| 2 | 15682 | 15951 | + | NZ_CP057659.1 | Escherichia fergusonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002128.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06924.13 | 1.0 | 2 | 1229.0 | same-strand | Protein of unknown function (DUF1281) |
| 2 | PF18406.3 | 1.0 | 2 | 1229.0 | same-strand | Ferredoxin-like domain in Api92-like protein |
| 3 | PF07128.14 | 1.0 | 2 | 3446.5 | same-strand | Protein of unknown function (DUF1380) |
++ More..