| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin ChpS |
| NCBI Accession ID | D16451.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 151 |
| Right | 402 |
| Strand | + |
| Nucleotide Sequence | ATGCGTATTACCATAAAAAGATGGGGGAACAGTGCAGGTATGGTCATTCCCAATATCGTAATGAAAGAACTTAACTTACAGCCGGGGCAGAGCGTGGAGGCGCAAGTGAGCAACAATCAACTGATTCTGACACCCATCTCCAGGCGCTACTCGCTTGATGAACTGCTGGCACAGTGTGACATGAACGCCGCGGAACTTAGCGAGCAGGATGTCTGGGGTAAATCCACCCCTGCGGGTGACGAAATATGGTAA |
| Sequence | MRITIKRWGNSAGMVIPNIVMKELNLQPGQSVEAQVSNNQLILTPISRRYSLDELLAQCDMNAAELSEQDVWGKSTPAGDEIW |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. May be involved in the regulation of cell growth. It acts as a suppressor of the endoribonuclease (inhibitory function) of ChpB protein. Both ChpS and ChpB probably bind to the promoter region of the chpS-chpB operon to autoregulate their synthesis. {ECO:0000269|Pubmed:16413033, ECO:0000269|Pubmed:8226627}. |
| Pubmed ID | 8226627 3525538 7610040 9278503 16738553 8083180 16413033 |
| Domain | CDD:412624 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | P08365 |
| ORF Length (Amino Acid) | 83 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4448447 | 4448698 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 5304054 | 5304305 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 3810644 | 3810895 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3015432 | 3015683 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 5 | 3467114 | 3467365 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 6 | 4072443 | 4072697 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 7 | 1027409 | 1027660 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01625.23 | 0.83 | 5 | 6275.0 | opposite-strand | Peptide methionine sulfoxide reductase |
| 2 | PF01103.25 | 0.83 | 5 | 4332.0 | same-strand | Omp85 superfamily domain |
| 3 | PF17243.4 | 0.83 | 5 | 4332.0 | same-strand | POTRA domain TamA domain 1 |
| 4 | PF04357.15 | 0.83 | 5 | 556.0 | same-strand | TamB, inner membrane protein subunit of TAM complex |
| 5 | PF06094.14 | 0.83 | 5 | 212.0 | same-strand | Gamma-glutamyl cyclotransferase, AIG2-like |
| 6 | PF02452.19 | 0.83 | 5 | 30.0 | same-strand | PemK-like, MazF-like toxin of type II toxin-antitoxin system |
| 7 | PF00719.21 | 0.83 | 5 | 424.0 | opposite-strand | Inorganic pyrophosphatase |
| 8 | PF13407.8 | 0.67 | 4 | 1272.5 | same-strand | Periplasmic binding protein domain |
| 9 | PF00005.29 | 0.67 | 4 | 2360 | same-strand | ABC transporter |
| 10 | PF02653.18 | 0.67 | 4 | 3876 | same-strand | Branched-chain amino acid transport system / permease component |