| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein 2 in cox locus |
| NCBI Accession ID | X05828.1 |
| Organism | Paracoccus denitrificans |
| Left | 2813 |
| Right | 3082 |
| Strand | + |
| Nucleotide Sequence | ATGCTGCCCCAGGTCGAGCATGAGTTGCACAAGCGCCGCCGCAGCCGGAACATCGGCCTGCTGGTCGTGCTGCTGGCCTTCGTCGCGCTGGTCTTCGGGCTCTCGGTGGTCAAGATCACCCAGGGCGACATGATGCAGGGCTATGACCACCGGCCGCGCGCCTCGATGCTGCCGCCCGATCCCGATCCGCCGGCGCCGAATGCCGCGCCCGTGGCCGCGCCGGGCACCCCTGCCGCCACGCAGGGCGTCACGCAGGAGGCGAACCAATGA |
| Sequence | MLPQVEHELHKRRRSRNIGLLVVLLAFVALVFGLSVVKITQGDMMQGYDHRPRASMLPPDPDPPAPNAAPVAAPGTPAATQGVTQEANQ |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 16453796 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P08302 |
| ORF Length (Amino Acid) | 89 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1971498 | 1971770 | + | NZ_CP024422.1 | Paracoccus yeei |
| 2 | 2482095 | 2482367 | + | NZ_CP030239.1 | Paracoccus mutanolyticus |
| 3 | 1264196 | 1264450 | + | NZ_LN832559.1 | Paracoccus aminovorans |
| 4 | 334080 | 334352 | + | NZ_CP025583.1 | Paracoccus jeotgali |
| 5 | 1925483 | 1925728 | + | NZ_CP020612.1 | Paracoccus contaminans |
| 6 | 675005 | 675226 | + | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 7 | 1106642 | 1106878 | - | NZ_CP020470.1 | Rhodobacter blasticus |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02481.17 | 0.71 | 5 | 3527 | opposite-strand | DNA recombination-mediator protein A |
| 2 | PF17782.3 | 0.71 | 5 | 3527 | opposite-strand | DprA winged helix domain |
| 3 | PF19289.1 | 1.0 | 7 | 2070 | opposite-strand | PmbA/TldA metallopeptidase C-terminal domain |
| 4 | PF19290.1 | 1.0 | 7 | 2070 | opposite-strand | PmbA/TldA metallopeptidase central domain |
| 5 | PF01523.18 | 0.86 | 6 | 2029.5 | opposite-strand | PmbA/TldA metallopeptidase domain 1 |
| 6 | PF00116.22 | 1.0 | 7 | 927 | same-strand | Cytochrome C oxidase subunit II, periplasmic domain |
| 7 | PF02790.17 | 1.0 | 7 | 927 | same-strand | Cytochrome C oxidase subunit II, transmembrane domain |
| 8 | PF01040.20 | 1.0 | 7 | 0 | same-strand | UbiA prenyltransferase family |
| 9 | PF04442.16 | 1.0 | 7 | -3 | same-strand | Cytochrome c oxidase assembly protein CtaG/Cox11 |
| 10 | PF00510.20 | 0.86 | 6 | 621.0 | same-strand | Cytochrome c oxidase subunit III |
| 11 | PF02104.17 | 0.86 | 6 | 1525.5 | same-strand | SURF1 family |
| 12 | PF14821.8 | 0.86 | 6 | 2205.5 | same-strand | Threonine synthase N terminus |
| 13 | PF00291.27 | 0.71 | 5 | 2191 | same-strand | Pyridoxal-phosphate dependent enzyme |
| 14 | PF00675.22 | 0.86 | 6 | 3584.5 | same-strand | Insulinase (Peptidase family M16) |
| 15 | PF05193.23 | 0.86 | 6 | 3584.5 | same-strand | Peptidase M16 inactive domain |