Protein Information |
Information Type | Description |
---|---|
Protein name | Lantibiotic epidermin |
NCBI Accession ID | X07840.1 |
Organism | Staphylococcus epidermidis |
Left | 162 |
Right | 320 |
Strand | + |
Nucleotide Sequence | ATGGAAGCAGTAAAAGAAAAAAATGATCTTTTTAATCTTGATGTTAAAGTTAATGCAAAAGAATCTAACGATTCAGGAGCTGAACCAAGAATTGCTAGTAAATTTATATGTACTCCTGGATGTGCAAAAACAGGTAGTTTTAACAGTTATTGTTGTTAA |
Sequence | MEAVKEKNDLFNLDVKVNAKESNDSGAEPRIASKFICTPGCAKTGSFNSYCC |
Source of smORF | Swiss-Prot |
Function | Lanthionine-containing peptide antibiotic (lantibiotic) active on Gram-positive bacteria. The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores. |
Pubmed ID | 2835685 1740156 3769923 11101502 |
Domain | CDD:413688 |
Functional Category | Antimicrobial |
Uniprot ID | P08136 |
ORF Length (Amino Acid) | 52 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1857745 | 1857888 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
2 | 1858625 | 1858768 | - | NC_007795.1 | Staphylococcus aureus subsp. aureus NCTC 8325 |
3 | 1515280 | 1515420 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
4 | 1900589 | 1900732 | - | NZ_LR134304.1 | Staphylococcus schweitzeri |
5 | 337099 | 337233 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05147.15 | 1.0 | 4 | 3062 | same-strand | Lanthionine synthetase C-like protein |
2 | PF04738.15 | 1.0 | 4 | 65 | same-strand | Lantibiotic dehydratase, N terminus |
3 | PF14028.8 | 1.0 | 4 | 65 | same-strand | Lantibiotic biosynthesis dehydratase C-term |