Protein Information |
Information Type | Description |
---|---|
Protein name | Spore coat protein D |
NCBI Accession ID | X05681.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 258 |
Right | 485 |
Strand | + |
Nucleotide Sequence | ATGCATCACTGCAGACCGCATATGATGGCGCCAATTGTCCATCCTACTCATTGCTGTGAACACCATACGTTTTCGAAGACTATCGTGCCGCACATTCACCCACAGCATACAACAAACGTAAACCACCAGCATTTTCAGCACGTTCACTACTTTCCACACACTTTCTCAAATGTTGACCCGGCTACGCATCAGCATTTTCAAGCAGGAAAACCTTGCTGCGACTACTAG |
Sequence | MHHCRPHMMAPIVHPTHCCEHHTFSKTIVPHIHPQHTTNVNHQHFQHVHYFPHTFSNVDPATHQHFQAGKPCCDY |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 2821284 8760912 9384377 1691789 |
Domain | |
Functional Category | Others |
Uniprot ID | P07791 |
ORF Length (Amino Acid) | 75 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2332784 | 2333011 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 3923629 | 3923856 | + | NZ_CP029364.1 | Bacillus halotolerans |
3 | 2141920 | 2142147 | - | NZ_CP013984.1 | Bacillus inaquosorum |
4 | 2130711 | 2130938 | - | NZ_CP051464.1 | Bacillus mojavensis |
5 | 2202062 | 2202286 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
6 | 2288401 | 2288625 | - | NZ_CP033052.1 | Bacillus vallismortis |
7 | 1783018 | 1783221 | + | NZ_CP011937.1 | Bacillus velezensis |
8 | 2216745 | 2216948 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
9 | 3454864 | 3455088 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
10 | 2195059 | 2195295 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
11 | 2192673 | 2192921 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
12 | 2381916 | 2382131 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
13 | 2385747 | 2386001 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
14 | 3349727 | 3349963 | + | NZ_CP017786.1 | Bacillus xiamenensis |
15 | 2031256 | 2031492 | - | NZ_CP011150.1 | Bacillus altitudinis |
16 | 2293873 | 2294109 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
17 | 2291443 | 2291694 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
18 | 3257374 | 3257613 | + | NZ_CP043404.1 | Bacillus safensis |
19 | 3513735 | 3513962 | - | NZ_CP017703.1 | Aeribacillus pallidus |
20 | 1519123 | 1519335 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
21 | 1462602 | 1462814 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
22 | 1759926 | 1760138 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
23 | 1941128 | 1941340 | + | NZ_CP070511.1 | Parageobacillus toebii |
24 | 1803698 | 1803916 | - | NZ_CP014342.1 | Geobacillus subterraneus |
25 | 561345 | 561554 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01170.20 | 0.86 | 18 | 1552.5 | same-strand | Putative RNA methylase family UPF0020 |
2 | PF02926.19 | 0.86 | 18 | 1552.5 | same-strand | THUMP domain |
3 | PF06908.13 | 0.71 | 15 | 88 | same-strand | YspA SLOG family |
4 | PF13482.8 | 0.76 | 16 | 316.0 | same-strand | RNase H superfamily |
5 | PF00270.31 | 0.76 | 16 | 1587.5 | same-strand | DEAD/DEAH box helicase |
6 | PF09369.12 | 0.76 | 16 | 1587.5 | same-strand | Domain of unknown function (DUF1998) |
7 | PF00271.33 | 0.76 | 16 | 1587.5 | same-strand | Helicase conserved C-terminal domain |
8 | PF04851.17 | 0.67 | 14 | 1587.5 | same-strand | Type III restriction enzyme, res subunit |