| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0235 protein Dred_0717 |
| NCBI Accession ID | CP000612.1 |
| Organism | Desulfotomaculum reducens (strain MI-1) |
| Left | 769567 |
| Right | 769851 |
| Strand | + |
| Nucleotide Sequence | ATGTTTGATATAAAAGAGGATCAAAATGGTGTGGTGGTAAAAGTACGGGTTCAGCCTAGGGCTTCCAAGAACAGCCTAGCCGGGGAGATGGAGGGGGCCCTTAAAGTGCGCCTTACGGCACCACCGGTGGACGGAGCTGCTAACGAAGCCTGCTGCAAGTTTTTTGGGGAACTCTTCGGAGTGGCAAAATCGAAGGTAGAAATCATAGCCGGACATACCGGACGCAATAAGCTAGTCCACATACAGGGGGTCACCGAGAAACAGGCACGATTTATCTTGAAGTAG |
| Sequence | MFDIKEDQNGVVVKVRVQPRASKNSLAGEMEGALKVRLTAPPVDGAANEACCKFFGELFGVAKSKVEIIAGHTGRNKLVHIQGVTEKQARFILK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
| Pubmed ID | |
| Domain | CDD:412584 |
| Functional Category | Others |
| Uniprot ID | A4J2F3 |
| ORF Length (Amino Acid) | 94 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 769567 | 769851 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 2 | 3364113 | 3364400 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 3 | 3624718 | 3625005 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 4 | 1112294 | 1112590 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 5 | 330070 | 330348 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 6 | 1796345 | 1796632 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 7 | 47492 | 47785 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 8 | 2168951 | 2169253 | - | NZ_CP036259.1 | Sporomusa termitida |
| 9 | 1310863 | 1311120 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 10 | 856284 | 856526 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 11 | 2522565 | 2522801 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 12 | 2681396 | 2681638 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 13 | 3443672 | 3443908 | - | NZ_CP041352.1 | Casimicrobium huifangae |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04472.14 | 0.69 | 9 | 2110 | same-strand | Cell division protein SepF |
| 2 | PF00133.24 | 0.62 | 8 | 864.5 | same-strand | tRNA synthetases class I (I, L, M and V) |
| 3 | PF08264.15 | 0.62 | 8 | 864.5 | same-strand | Anticodon-binding domain of tRNA ligase |
| 4 | PF06827.16 | 0.62 | 8 | 864.5 | same-strand | Zinc finger found in FPG and IleRS |
| 5 | PF02325.19 | 0.69 | 9 | 1319 | same-strand | YGGT family |
| 6 | PF14748.8 | 0.62 | 8 | 1434.5 | same-strand | Pyrroline-5-carboxylate reductase dimerisation |
| 7 | PF03807.19 | 0.62 | 8 | 1434.5 | same-strand | NADP oxidoreductase coenzyme F420-dependent |