| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein gamma-type (SASP) |
| NCBI Accession ID | M16813.1 |
| Organism | Bacillus cereus |
| Left | 43 |
| Right | 324 |
| Strand | + |
| Nucleotide Sequence | ATGAGTAAAAAACAACAAGGTTATAACAAAGCAACTTCTGGTGCTAGCATTCAAAGTACAAATGCTAGTTATGGTACAGAGTTTTCAACTGAAACAGATGTACAAGCTGTAAAACAAGCAAACGCACAATCAGAAGCAAAGAAAGCACAAGCTTCTGGTGCACAAAGTGCAAACGCTAGTTATGGTACAGAATTTGCAACTGAAACAGACGTGCATTCTGTGAAAAAACAAAATGCTAAGTCAGCTGCAAAACAATCACAATCTTCTAGCTCAAATCAGTAA |
| Sequence | MSKKQQGYNKATSGASIQSTNASYGTEFSTETDVQAVKQANAQSEAKKAQASGAQSANASYGTEFATETDVHSVKKQNAKSAAKQSQSSSSNQ |
| Source of smORF | Swiss-Prot |
| Function | SASP are proteins degraded in the first minutes of spore germination and provide amino acids for both new protein synthesis and metabolism. These proteins may be involved in dormant spore's high resistance to UV light. |
| Pubmed ID | 3036769 |
| Domain | CDD:389879 |
| Functional Category | Others |
| Uniprot ID | P07787 |
| ORF Length (Amino Acid) | 93 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 510276 | 510557 | + | NC_011725.1 | Bacillus cereus B4264 |
| 2 | 512563 | 512844 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 3 | 4609635 | 4609916 | - | NZ_CP040336.1 | Bacillus luti |
| 4 | 501119 | 501400 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 5 | 516465 | 516752 | + | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 6 | 492080 | 492361 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08176.14 | 0.83 | 5 | 3098 | opposite-strand | Small acid-soluble spore protein K family |
| 2 | PF14043.8 | 1.0 | 6 | 2749.5 | same-strand | WVELL protein |
| 3 | PF04307.16 | 1.0 | 6 | 1744.0 | opposite-strand | LexA-binding, inner membrane-associated putative hydrolase |
| 4 | PF00730.27 | 1.0 | 6 | 497.0 | same-strand | HhH-GPD superfamily base excision DNA repair protein |
| 5 | PF14815.8 | 1.0 | 6 | 497.0 | same-strand | NUDIX domain |
| 6 | PF00633.25 | 1.0 | 6 | 497.0 | same-strand | Helix-hairpin-helix motif |
| 7 | PF14182.8 | 1.0 | 6 | 189.0 | same-strand | YgaB-like protein |
| 8 | PF04167.15 | 1.0 | 6 | 711.5 | same-strand | Protein of unknown function (DUF402) |
| 9 | PF00664.25 | 1.0 | 6 | 1296.5 | same-strand | ABC transporter transmembrane region |
| 10 | PF00005.29 | 1.0 | 6 | 1296.5 | same-strand | ABC transporter |
| 11 | PF06081.13 | 1.0 | 6 | 3071.5 | opposite-strand | Aromatic acid exporter family member 1 |
| 12 | PF13515.8 | 1.0 | 6 | 3071.5 | opposite-strand | Fusaric acid resistance protein-like |
| 13 | PF01645.19 | 1.0 | 6 | 4431.0 | opposite-strand | Conserved region in glutamate synthase |
| 14 | PF04898.16 | 1.0 | 6 | 4431.0 | opposite-strand | Glutamate synthase central domain |
| 15 | PF00310.23 | 1.0 | 6 | 4431.0 | opposite-strand | Glutamine amidotransferases class-II |