Result : P07786
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein gamma-type (SASP) |
| NCBI Accession ID | M16815.1 |
| Organism | Laceyella sacchari (Thermoactinomyces thalpophilus) |
| Left | 262 |
| Right | 552 |
| Strand | + |
| Nucleotide Sequence | ATGAACACCAAAAACTTTACTCCACAAGAATCGAGAACCAATGCACAACAAGTTCGCCAACAAAACCAGCAATCCGCTCAAGGTACTTCCAGCGGTTTTGCAACGGAGTTCGCCAGCGAAACCAATGCACAACAAGTCCGCCAACAAAACCAACAATCCGCTCAAGCTAATCGCATGTCCGGTGCGACCGCAGGCGGCTTCAACACGGAGTTCGCTAGCGAAACCAACGTACAACAAGTTCGCCAACAAAACCAACAATCCGAGGCTAAAAAGCGTAACAACCAACAATAA |
| Sequence | MNTKNFTPQESRTNAQQVRQQNQQSAQGTSSGFATEFASETNAQQVRQQNQQSAQANRMSGATAGGFNTEFASETNVQQVRQQNQQSEAKKRNNQQ |
| Source of smORF | Swiss-Prot |
| Function | SASP are proteins degraded in the first minutes of spore germination and provide amino acids for both new protein synthesis and metabolism. These proteins may be involved in dormant spore's high resistance to UV light. |
| Pubmed ID | 3036769 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P07786 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 937900 | 938154 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 908700 | 908957 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1060308 | 1060565 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 928910 | 929167 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 5 | 919641 | 919898 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 6 | 2554202 | 2554498 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 7 | 872161 | 872421 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 395035 | 395280 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 9 | 784768 | 785079 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 10 | 2802618 | 2802902 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 11 | 724293 | 724589 | + | NZ_CP012024.1 | Bacillus smithii |
| 12 | 1119487 | 1119741 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 13 | 1856656 | 1856931 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 14 | 3181787 | 3182059 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04307.16 | 0.86 | 12 | 2465.5 | opposite-strand | LexA-binding, inner membrane-associated putative hydrolase |
| 2 | PF14815.8 | 0.86 | 12 | 1136.0 | same-strand | NUDIX domain |
| 3 | PF00730.27 | 0.86 | 12 | 1136.0 | same-strand | HhH-GPD superfamily base excision DNA repair protein |
| 4 | PF00633.25 | 0.71 | 10 | 1135.0 | same-strand | Helix-hairpin-helix motif |
| 5 | PF13561.8 | 0.86 | 12 | 70.5 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 6 | PF00106.27 | 0.86 | 12 | 70.5 | same-strand | short chain dehydrogenase |
| 7 | PF14182.8 | 0.79 | 11 | 174 | same-strand | YgaB-like protein |
| 8 | PF04167.15 | 0.86 | 12 | 578.0 | same-strand | Protein of unknown function (DUF402) |
| 9 | PF00664.25 | 0.86 | 12 | 1194.5 | same-strand | ABC transporter transmembrane region |
| 10 | PF00005.29 | 0.86 | 12 | 1195.0 | same-strand | ABC transporter |
++ More..