Protein Information |
Information Type | Description |
---|---|
Protein name | Light-harvesting protein B-800/850 beta chain (Antenna pigment protein beta chain) (LH-3B) |
NCBI Accession ID | K02337.1 |
Organism | Rhodobacter capsulatus (Rhodopseudomonas capsulata) |
Left | 198 |
Right | 347 |
Strand | + |
Nucleotide Sequence | ATGACTGACGATAAAGCTGGGCCGAGCGGCCTGTCGCTGAAAGAAGCTGAAGAAATCCACAGCTACCTGATCGATGGCACCCGTGTGTTCGGGGCGATGGCGCTTGTTGCGCACATCCTCTCGGCCATCGCCACGCCGTGGCTCGGGTAA |
Sequence | MTDDKAGPSGLSLKEAEEIHSYLIDGTRVFGAMALVAHILSAIATPWLG |
Source of smORF | Swiss-Prot |
Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
Pubmed ID | 16593533 2549005 |
Domain | CDD:395441 |
Functional Category | Metal-binding |
Uniprot ID | P07368 |
ORF Length (Amino Acid) | 49 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2233420 | 2233569 | + | NZ_CP061202.1 | Rhodobacter capsulatus |
2 | 2675586 | 2675741 | + | NC_015730.1 | Roseobacter litoralis Och 149 |
3 | 1434091 | 1434246 | + | NZ_CP027407.1 | Roseobacter denitrificans |
4 | 3028238 | 3028390 | - | NZ_CP034348.1 | Roseovarius faecimaris |
5 | 3055850 | 3056005 | - | NC_009952.1 | Dinoroseobacter shibae DFL 12 = DSM 16493 |
6 | 1948034 | 1948189 | + | NZ_CP015421.1 | Rhodovulum sulfidophilum |
7 | 1020887 | 1021042 | + | NZ_CP020470.1 | Rhodobacter blasticus |
8 | 1644445 | 1644597 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
9 | 2541472 | 2541612 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
10 | 1643519 | 1643659 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
11 | 1644932 | 1645084 | - | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
12 | 2540365 | 2540517 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
13 | 4694534 | 4694689 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
14 | 1568948 | 1569103 | + | NZ_CP058907.1 | Rhodopseudomonas palustris |
15 | 2897577 | 2897720 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
16 | 1522807 | 1522965 | + | NC_008789.1 | Halorhodospira halophila SL1 |
17 | 321308 | 321463 | - | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
18 | 1243496 | 1243648 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00556.22 | 1.0 | 12 | 35 | same-strand | Antenna complex alpha/beta subunit |
2 | PF03209.17 | 0.92 | 11 | 420.5 | same-strand | PUCC protein |