Protein Information |
Information Type | Description |
---|---|
Protein name | Small, acid-soluble spore protein H 3 (SASP H 3) |
NCBI Accession ID | CP000557.1 |
Organism | Geobacillus thermodenitrificans (strain NG80-2) |
Left | 2985197 |
Right | 2985394 |
Strand | - |
Nucleotide Sequence | ATGGACATGAACCGTGTGAAACAAATCGTTTCATCACCTGCCGATATTCCTGTGTATTACAACGGGGTATCGGTTTGGATTGACGGGTATGACGAAGAAAACCAAATGGCAACTGTCCATTTGCGCGACGGCCGGCTCAATGAGCGTCGGGACGTGCCGGTGGCCGAACTGGAGGAAAAAGGAGAAGCCGCCCACTAA |
Sequence | MDMNRVKQIVSSPADIPVYYNGVSVWIDGYDEENQMATVHLRDGRLNERRDVPVAELEEKGEAAH |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl06949. Profile Description: Small acid-soluble spore protein H family. This model is derived from pfam08141 but has been expanded to include in the seed corresponding proteins from three species of Clostridium. Members of this family should occur only in endospore-forming bacteria, typically with two members per genome, but may be absent from the genomes of some endospore-forming bacteria. SspH (previously designated YfjU) was shown to be expressed specifically in spores of Bacillus subtilis. [Cellular processes, Sporulation and germination] |
Pubmed ID | 17372208 |
Domain | CDD:414973 |
Functional Category | Others |
Uniprot ID | A4ISB5 |
ORF Length (Amino Acid) | 65 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 341099 | 341281 | + | NZ_CP014342.1 | Geobacillus subterraneus |
2 | 3865486 | 3865671 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
3 | 7963 | 8148 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
4 | 2571147 | 2571329 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
5 | 658230 | 658418 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
6 | 2382110 | 2382289 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
7 | 598102 | 598293 | - | NZ_CP012024.1 | Bacillus smithii |
8 | 3985488 | 3985667 | + | NZ_CP017703.1 | Aeribacillus pallidus |
9 | 1766484 | 1766663 | - | NZ_CP016020.1 | Bacillus weihaiensis |
10 | 2940987 | 2941166 | - | NZ_CP042593.1 | Bacillus dafuensis |
11 | 2071908 | 2072093 | + | NZ_LS483476.1 | Lederbergia lentus |
12 | 2441838 | 2442023 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
13 | 2890331 | 2890510 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
14 | 1201785 | 1201967 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
15 | 3856035 | 3856214 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
16 | 765954 | 766133 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
17 | 3639652 | 3639834 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
18 | 2966024 | 2966203 | - | NZ_CP053989.1 | Niallia circulans |
19 | 1337487 | 1337675 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |