Result : P07010
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Rem |
| NCBI Accession ID | X02405.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 1464 |
| Right | 1715 |
| Strand | + |
| Nucleotide Sequence | ATGATGAACATCGAAGAACTGCGTAAAATTTTTTGTGAAGATGGCCTCTATGCTGTGTGCGTTGAAAATGGAAATCTTGTTAGTCATTACCGCATTATGTGTTTGCGAAAGAATGGGGCTGCGTTAATTAATTTTGTGGATGCTCGGGTCACGGACGGATTTATCTTGCGCGAAGGTGAGTTTGTCACTTCATTACAGGCATTGAAAGAGATCGGAATAAAAGCTGGCTTTTCTGCTTTTTCAGGAGAATAA |
| Sequence | MMNIEELRKIFCEDGLYAVCVENGNLVSHYRIMCLRKNGAALINFVDARVTDGFILREGEFVTSLQALKEIGIKAGFSAFSGE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 2990907 9097039 9278503 16738553 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P07010 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1644651 | 1644902 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1334944 | 1335195 | + | NZ_AP014857.1 | Escherichia albertii |
| 3 | 2008414 | 2008677 | - | NZ_AP014857.1 | Escherichia albertii |
| 4 | 1581003 | 1581254 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 905393 | 905680 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 2285700 | 2285951 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 7 | 3058644 | 3058931 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 8 | 1769823 | 1770083 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03589.15 | 1.0 | 4 | 1780.0 | same-strand | Antitermination protein |
| 2 | PF01848.18 | 1.0 | 4 | 218.0 | same-strand | Hok/gef family |
| 3 | PF05866.13 | 1.0 | 4 | 1409 | same-strand | Endodeoxyribonuclease RusA |
++ More..