Result : P06965
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Repressor protein of division inhibition gene dicB |
| NCBI Accession ID | X07465.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 39 |
| Right | 269 |
| Strand | - |
| Nucleotide Sequence | ATGCTTAAAACTGACGCTCTTTTGTATTTCGGTTCAAAAACAAAACTTGCACAAGCAGCAGGTATTCGTTTGGCTTCGCTTTATAGCTGGAAAGGGGATTTAGTTCCCGAAGGTCGCGCGATGCGTCTACAGGAGGCATCTGGCGGGGAGCTTCAGTATGATCCCAAAGTTTATGATGAATATCGTAAGACGAAGCGGGCGGGGCGGTTGAACAATGAAAATCACTCCTGA |
| Sequence | MLKTDALLYFGSKTKLAQAAGIRLASLYSWKGDLVPEGRAMRLQEASGGELQYDPKVYDEYRKTKRAGRLNNENHS |
| Source of smORF | Swiss-Prot |
| Function | This protein is a repressor of division inhibition gene dicB. |
| Pubmed ID | 3532030 2836697 9097039 9278503 16738553 |
| Domain | CDD:419869 |
| Functional Category | DNA-binding |
| Uniprot ID | P06965 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1647620 | 1647850 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2013710 | 2013940 | - | NZ_AP014857.1 | Escherichia albertii |
| 3 | 1329938 | 1330165 | + | NZ_AP014857.1 | Escherichia albertii |
| 4 | 1764500 | 1764727 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 910006 | 910233 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 1695141 | 1695374 | - | NZ_CP028271.1 | Mixta intestinalis |
| 7 | 490902 | 491144 | - | NZ_CP034149.1 | Pantoea agglomerans |
| 8 | 2158576 | 2158791 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 9 | 4575600 | 4575809 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 10 | 1672296 | 1672535 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01381.24 | 0.62 | 5 | 81 | opposite-strand | Helix-turn-helix |
| 2 | PF12844.9 | 0.62 | 5 | 81 | opposite-strand | Helix-turn-helix domain |
| 3 | PF13560.8 | 0.62 | 5 | 81 | opposite-strand | Helix-turn-helix domain |
| 4 | PF06254.13 | 0.62 | 5 | -16.0 | same-strand | Putative bacterial toxin ydaT |
++ More..