Protein Information |
Information Type | Description |
---|---|
Protein name | Nodulation protein F (Host-specificity of nodulation protein A) |
NCBI Accession ID | X04379.1 |
Organism | Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) |
Left | 406 |
Right | 687 |
Strand | + |
Nucleotide Sequence | ATGGTAGATCAACTCGAAAGCGAAATCATTGGCATCATCAAGAACCGTGTCGAATCGGAGGGCGGCGATGGAGAGACCGCGTTAATAGTCGGCGATTTAACGGCTGCCACTGAATTGACCGCGCTTGGTGTCGATTCTCTCGGATTGGCAGACATCATCTGGGACGTGGAACAGGCCTACGGTATCAGGATCGAGATGAACACGGCCGAGGCGTGGTCGGATCTCCAGAACGTCGGCGACATAGTGGGAGCCATCCGAGGCTTGCTCACTAAGGGGGCTTGA |
Sequence | MVDQLESEIIGIIKNRVESEGGDGETALIVGDLTAATELTALGVDSLGLADIIWDVEQAYGIRIEMNTAEAWSDLQNVGDIVGAIRGLLTKGA |
Source of smORF | Swiss-Prot |
Function | Proposed to synthesize nod factor fatty acyl chain. Involved in trans-2,trans-4,trans-6,cis-11-octadecatetraenoic acid biosynthesis. |
Pubmed ID | 3020515 17246400 11481432 11474104 |
Domain | CDD:415812 |
Functional Category | Others |
Uniprot ID | P06232 |
ORF Length (Amino Acid) | 93 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 469291 | 469572 | + | NC_020527.1 | Sinorhizobium meliloti 2011 |
2 | 6758066 | 6758347 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
3 | 410750 | 411031 | + | NZ_CP050299.1 | Mesorhizobium huakuii |
4 | 5989534 | 5989815 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
5 | 572350 | 572604 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
6 | 6615245 | 6615526 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
7 | 585799 | 586053 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
8 | 960962 | 961237 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
9 | 6398234 | 6398497 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
10 | 611233 | 611487 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
11 | 25269 | 25550 | - | NZ_CP034911.1 | Ensifer alkalisoli |
12 | 205405 | 205683 | + | NZ_CP071608.1 | Rhizobium binae |
13 | 91333 | 91611 | - | NZ_CP071610.1 | Rhizobium binae |
14 | 180758 | 181036 | - | NZ_CP054030.1 | Rhizobium hidalgonense |
15 | 150362 | 150640 | - | NZ_CP071458.1 | Rhizobium lentis |
16 | 168620 | 168898 | + | NZ_CP071615.1 | Rhizobium bangladeshense |
17 | 226134 | 226412 | + | NZ_CP054024.1 | Rhizobium indicum |
18 | 297174 | 297452 | - | NZ_CP071682.1 | Rhizobium ruizarguesonis |
19 | 1112601 | 1112879 | + | NZ_HG938354.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
20 | 145431 | 145706 | + | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
21 | 3925336 | 3925590 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03466.22 | 0.65 | 11 | 661.0 | same-strand | LysR substrate binding domain |
2 | PF00126.29 | 0.65 | 11 | 661.0 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
3 | PF00109.28 | 1.0 | 17 | 1 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
4 | PF02801.24 | 1.0 | 17 | 1 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
5 | PF02474.17 | 0.82 | 14 | 1851 | same-strand | Nodulation protein A (NodA) |