Result : P06232
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Nodulation protein F (Host-specificity of nodulation protein A) |
| NCBI Accession ID | X04379.1 |
| Organism | Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) |
| Left | 406 |
| Right | 687 |
| Strand | + |
| Nucleotide Sequence | ATGGTAGATCAACTCGAAAGCGAAATCATTGGCATCATCAAGAACCGTGTCGAATCGGAGGGCGGCGATGGAGAGACCGCGTTAATAGTCGGCGATTTAACGGCTGCCACTGAATTGACCGCGCTTGGTGTCGATTCTCTCGGATTGGCAGACATCATCTGGGACGTGGAACAGGCCTACGGTATCAGGATCGAGATGAACACGGCCGAGGCGTGGTCGGATCTCCAGAACGTCGGCGACATAGTGGGAGCCATCCGAGGCTTGCTCACTAAGGGGGCTTGA |
| Sequence | MVDQLESEIIGIIKNRVESEGGDGETALIVGDLTAATELTALGVDSLGLADIIWDVEQAYGIRIEMNTAEAWSDLQNVGDIVGAIRGLLTKGA |
| Source of smORF | Swiss-Prot |
| Function | Proposed to synthesize nod factor fatty acyl chain. Involved in trans-2,trans-4,trans-6,cis-11-octadecatetraenoic acid biosynthesis. |
| Pubmed ID | 3020515 17246400 11481432 11474104 |
| Domain | CDD:415812 |
| Functional Category | Others |
| Uniprot ID | P06232 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 469291 | 469572 | + | NC_020527.1 | Sinorhizobium meliloti 2011 |
| 2 | 6758066 | 6758347 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 3 | 410750 | 411031 | + | NZ_CP050299.1 | Mesorhizobium huakuii |
| 4 | 5989534 | 5989815 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 5 | 572350 | 572604 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
| 6 | 6615245 | 6615526 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 7 | 585799 | 586053 | - | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 8 | 960962 | 961237 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 9 | 6398234 | 6398497 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 10 | 611233 | 611487 | - | NZ_CP033361.1 | Mesorhizobium erdmanii |
| 11 | 25269 | 25550 | - | NZ_CP034911.1 | Ensifer alkalisoli |
| 12 | 205405 | 205683 | + | NZ_CP071608.1 | Rhizobium binae |
| 13 | 91333 | 91611 | - | NZ_CP071610.1 | Rhizobium binae |
| 14 | 180758 | 181036 | - | NZ_CP054030.1 | Rhizobium hidalgonense |
| 15 | 150362 | 150640 | - | NZ_CP071458.1 | Rhizobium lentis |
| 16 | 168620 | 168898 | + | NZ_CP071615.1 | Rhizobium bangladeshense |
| 17 | 226134 | 226412 | + | NZ_CP054024.1 | Rhizobium indicum |
| 18 | 297174 | 297452 | - | NZ_CP071682.1 | Rhizobium ruizarguesonis |
| 19 | 1112601 | 1112879 | + | NZ_HG938354.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 20 | 145431 | 145706 | + | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
| 21 | 3925336 | 3925590 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019973.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03466.22 | 0.65 | 11 | 661.0 | same-strand | LysR substrate binding domain |
| 2 | PF00126.29 | 0.65 | 11 | 661.0 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 3 | PF00109.28 | 1.0 | 17 | 1 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
| 4 | PF02801.24 | 1.0 | 17 | 1 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
| 5 | PF02474.17 | 0.82 | 14 | 1851 | same-strand | Nodulation protein A (NodA) |
++ More..