Protein Information |
Information Type | Description |
---|---|
Protein name | Relaxosome protein TraY |
NCBI Accession ID | M15136.1 |
Organism | Escherichia coli |
Left | 31 |
Right | 258 |
Strand | + |
Nucleotide Sequence | TTGAGCAGAAATATAATAAGGCCTGCTCCGGGCAATAAAGTTTTACTGGTATTGGACGATGCTACTAATCACAAGCTCTTAGGTGCCCGGGAACGTAGTGGGAGAACAAAAACTAATGAGGTGCTAGTCAGGTTACGTGATCATCTGAACCGTTTTCCTGACTTTTATAATCTGGATGCAATAAAGGAGGGAGCAGAGGAAACTGATTCGATAATTAAAGATCTTTAG |
Sequence | MSRNIIRPAPGNKVLLVLDDATNHKLLGARERSGRTKTNEVLVRLRDHLNRFPDFYNLDAIKEGAEETDSIIKDL |
Source of smORF | Swiss-Prot |
Function | Conjugative DNA transfer (CDT) is the unidirectional transfer of ssDNA plasmid from a donor to a recipient cell. It is the central mechanism by which antibiotic resistance and virulence factors are propagated in bacterial populations. Part of the relaxosome, which facilitates a site- and strand-specific cut in the origin of transfer by TraI, at the nic site. Relaxosome formation requires binding of IHF and TraY to the oriT region, which then facilitates binding of TraI. Also positively regulates tra gene expression (By similarity). {ECO:0000250}. |
Pubmed ID | 3531163 2836369 |
Domain | CDD:421433 |
Functional Category | DNA-binding |
Uniprot ID | P05835 |
ORF Length (Amino Acid) | 75 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 15440 | 15658 | - | NZ_CP026049.1 | Raoultella planticola |
2 | 77914 | 78132 | - | NC_016846.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
3 | 109854 | 110069 | - | NZ_CP026048.1 | Raoultella planticola |
4 | 62406 | 62588 | + | NC_003277.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03743.16 | 1.0 | 3 | 2059.0 | same-strand | Bacterial conjugation TrbI-like protein |
2 | PF06586.13 | 1.0 | 3 | 1322.0 | same-strand | TraK protein |
3 | PF05309.13 | 1.0 | 3 | 769.0 | same-strand | TraE protein |
4 | PF07178.13 | 1.0 | 3 | 444.0 | same-strand | TraL protein |
5 | PF05513.13 | 1.0 | 3 | 62.0 | same-strand | TraA |
6 | PF05261.13 | 0.67 | 2 | 1040 | same-strand | TraM protein, DNA-binding |
7 | PF01464.22 | 1.0 | 3 | 1837.5 | opposite-strand | Transglycosylase SLT domain |
8 | PF06067.13 | 0.67 | 2 | 2727.0 | same-strand | Domain of unknown function (DUF932) |