| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Bacteriocin microcin B17 (MccB17) |
| NCBI Accession ID | |
| Organism | Escherichia coli |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MELKASEFGVVLSVDALKLSRQSPLGVGIGGGGGGGGGGSCGGQGGGCGGCSNGCSGGNGGSGGSGSHI |
| Source of smORF | Swiss-Prot |
| Function | This glycine-rich peptide antibiotic inhibits DNA replication in many enteric bacteria, that leads to induction of the SOS repair system, massive DNA degradation and cell death. B17 inhibits type II topoisomerase by trapping an enzyme - DNA cleavable complex. {ECO:0000269|Pubmed:1846808}. |
| Pubmed ID | 3329729 2644225 2835580 8183941 1846808 9545435 |
| Domain | |
| Functional Category | Antimicrobial |
| Uniprot ID | P05834 |
| ORF Length (Amino Acid) | 69 |