Result : P05339
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Colanic acid capsular biosynthesis activation protein B |
| NCBI Accession ID | M15749.1 |
| Organism | Klebsiella aerogenes (Enterobacter aerogenes) |
| Left | 148 |
| Right | 330 |
| Strand | + |
| Nucleotide Sequence | ATGTTTCAACGCATCGGATTTCCCGGTGTAACGAATTTTCAAGTGCTTCTTGCATTAGCAAGTTTGATCCCGACTCCTGCGAGTCGGGATTTTTTTCGCCTGCCGCTAACGGTTGGCTTCACTGGCGCTGAAATCGTGAATATCGAGTTCGAATGCCTCCGCCAGCTCACGCCAGGTATGTGA |
| Sequence | MFQRIGFPGVTNFQVLLALASLIPTPASRDFFRLPLTVGFTGAEIVNIEFECLRQLTPGM |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 3309150 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P05339 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3417582 | 3417764 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 2 | 1965249 | 1965413 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 3 | 5301523 | 5301687 | - | NZ_CP026047.1 | Raoultella planticola |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP046672.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00128.26 | 1.0 | 3 | 2146 | opposite-strand | Alpha amylase, catalytic domain |
| 2 | PF02806.20 | 1.0 | 3 | 2146 | opposite-strand | Alpha amylase, C-terminal all-beta domain |
| 3 | PF13987.8 | 1.0 | 3 | 1686 | same-strand | YedD-like protein |
| 4 | PF00196.21 | 1.0 | 3 | 595 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 5 | PF10781.11 | 1.0 | 3 | 352 | same-strand | Dextransucrase DSRB |
| 6 | PF10733.11 | 1.0 | 3 | -59 | opposite-strand | Protein of unknown function (DUF2525) |
| 7 | PF00990.23 | 1.0 | 3 | 185 | same-strand | Diguanylate cyclase, GGDEF domain |
| 8 | PF05661.14 | 1.0 | 3 | 2222 | same-strand | Protein of unknown function (DUF808) |
| 9 | PF00892.22 | 1.0 | 3 | 3362 | opposite-strand | EamA-like transporter family |
| 10 | PF03852.17 | 1.0 | 3 | 4248 | same-strand | DNA mismatch endonuclease Vsr |
| 11 | PF17151.6 | 0.67 | 2 | 174.5 | same-strand | Periplasmic sensor domain |
++ More..