Result : A4IS33
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0457 protein GTNG_2792 |
| NCBI Accession ID | CP000557.1 |
| Organism | Geobacillus thermodenitrificans (strain NG80-2) |
| Left | 2909503 |
| Right | 2909784 |
| Strand | - |
| Nucleotide Sequence | GTGATGTCAGGGATAAAAGTAGAAAAATTAAATGATAAGTTAGTGATTAGTTGGTTGCTATCAAAAATAGAAGTACCCATTTCTGATATTGTAAAAGTAACATTTGACGATACTTATGGCGGGGAGGAGAAAACAGCTATTCGAATTGGCACACCATATGGAGCAACGGATAGACTGGTCATTTTAACACATTCCAACACCTATATTTTATTTACGACAGATGCCATCTCCATTAAAAATAAAATCTTCTCATTTATAAACGAACAACTCCAACAGAAATAA |
| Sequence | MMSGIKVEKLNDKLVISWLLSKIEVPISDIVKVTFDDTYGGEEKTAIRIGTPYGATDRLVILTHSNTYILFTTDAISIKNKIFSFINEQLQQK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 17372208 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | A4IS33 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1924407 | 1924727 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 2 | 2112129 | 2112383 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 3 | 2150040 | 2150300 | - | NZ_CP009288.1 | Paenibacillus durus |
| 4 | 2736626 | 2736856 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 5 | 3544429 | 3544659 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 6 | 2170300 | 2170554 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 1934246 | 1934512 | + | NZ_CP019401.1 | Planococcus faecalis |
| 8 | 823599 | 823826 | + | NZ_CP059540.1 | Planococcus maritimus |
| 9 | 1896700 | 1896966 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 10 | 2009048 | 2009302 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 11 | 1881098 | 1881349 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 12 | 598965 | 599231 | - | NZ_CP013023.1 | Paenibacillus bovis |
| 13 | 3204975 | 3205229 | + | NZ_CP032365.1 | Bacillus wiedmannii |
| 14 | 1165715 | 1165966 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 15 | 2343370 | 2343627 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 16 | 2630295 | 2630555 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 17 | 4705195 | 4705449 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 18 | 3327429 | 3327686 | + | NZ_CP064875.1 | Bacillus toyonensis |
| 19 | 4473615 | 4473878 | + | NZ_CP053989.1 | Niallia circulans |
++ More..