Result : P05043
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl-phosphate phosphatase Spo0E (EC 3.1.3.-) (Stage 0 sporulation protein E) (Stage 0 sporulation regulatory protein Spo0E) |
| NCBI Accession ID | Y00526.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 187 |
| Right | 444 |
| Strand | + |
| Nucleotide Sequence | ATGGGCGGTTCTTCTGAACAAGAAAGATTGTTGGTGTCTATTGATGAAAAAAGAAAGTTAATGATAGATGCCGCTAGAAAGCAGGGATTTACAGGGCATGACACGATCAGGCACAGTCAGGAGCTGGATTGTTTAATAAATGAATATCATCAGCTTATGCAAGAAAACGAACATTCCCAAGGGATTCAAGGCCTTGTAAAGAAATTAGGCTTGTGGCCCCGCAGAGATGTTATGCCAGCATATGATGCAAATAAATAG |
| Sequence | MGGSSEQERLLVSIDEKRKLMIDAARKQGFTGHDTIRHSQELDCLINEYHQLMQENEHSQGIQGLVKKLGLWPRRDVMPAYDANK |
| Source of smORF | Swiss-Prot |
| Function | Aspartyl-phosphate phosphatase which specifically dephosphorylates the sporulation transcription factor Spo0A-P and negatively regulates the sporulation initiation pathway in order to control the proper timing of sporulation. {ECO:0000269|Pubmed:11112444, ECO:0000269|Pubmed:12067336, ECO:0000269|Pubmed:15057450, ECO:0000269|Pubmed:18045868, ECO:0000269|Pubmed:8127878}. |
| Pubmed ID | 2838724 9384377 8127878 11112444 12067336 15057450 18045868 19332814 |
| Domain | CDD:401369 |
| Functional Category | Others |
| Uniprot ID | P05043 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1402354 | 1402611 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 2 | 1405815 | 1406072 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 3 | 1430684 | 1430941 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 4 | 1342774 | 1343031 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 1613123 | 1613380 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 553257 | 553514 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1441142 | 1441399 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2614069 | 2614329 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1346404 | 1346664 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP034943.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12710.9 | 1.0 | 9 | 1702 | same-strand | haloacid dehalogenase-like hydrolase |
| 2 | PF00596.23 | 1.0 | 9 | 1115 | same-strand | Class II Aldolase and Adducin N-terminal domain |
| 3 | PF03079.16 | 1.0 | 9 | 564 | same-strand | ARD/ARD' family |
| 4 | PF06803.14 | 0.78 | 7 | 203 | opposite-strand | Protein of unknown function (DUF1232) |
| 5 | PF02518.28 | 1.0 | 9 | 545 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 6 | PF00512.27 | 1.0 | 9 | 545 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 7 | PF01047.24 | 1.0 | 9 | 2258 | same-strand | MarR family |
| 8 | PF12802.9 | 1.0 | 9 | 2258 | same-strand | MarR family |
| 9 | PF13463.8 | 1.0 | 9 | 2258 | same-strand | Winged helix DNA-binding domain |
| 10 | PF13412.8 | 1.0 | 9 | 2258 | same-strand | Winged helix-turn-helix DNA-binding |
| 11 | PF13601.8 | 0.78 | 7 | 2258 | same-strand | Winged helix DNA-binding domain |
| 12 | PF13677.8 | 1.0 | 9 | 2734 | opposite-strand | Membrane MotB of proton-channel complex MotA/MotB |
| 13 | PF00691.22 | 1.0 | 9 | 2734 | opposite-strand | OmpA family |
| 14 | PF01618.18 | 1.0 | 9 | 3491 | opposite-strand | MotA/TolQ/ExbB proton channel family |
++ More..