Result : P04337
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative mercuric resistance protein |
| NCBI Accession ID | AH003427.2 |
| Organism | Shigella flexneri |
| Left | 4854 |
| Right | 5036 |
| Strand | + |
| Nucleotide Sequence | ATGCGCGCCAAGTCGGCCATCTTCTCGCGCACGTCCTTGAGCTTGTGTTCGGCCAGGCTGCTGGCCTCCTCGCAGTGGGTGCCATCGTCGAGCCGCAACAGCTCGGCAATCTCGTCCAGACTGAACCCCAGCCGCTGTGCCGATTTCACGAATTTCACCCGAACCACGTCCGCCTCCCCATAG |
| Sequence | MRAKSAIFSRTSLSLCSARLLASSQWVPSSSRNSSAISSRLNPSRCADFTNFTRTTSASP |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 6091128 6530603 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P04337 |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 38
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2759623 | 2759805 | - | NZ_CP015121.1 | Acinetobacter baumannii |
| 2 | 12023 | 12205 | + | NC_016846.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 3 | 5608653 | 5608835 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 4 | 76599 | 76781 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 5 | 1288135 | 1288317 | - | NZ_AP018795.1 | Acidithiobacillus ferridurans |
| 6 | 1850442 | 1850624 | + | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 7 | 44427 | 44609 | - | NC_008341.1 | Nitrosomonas eutropha C91 |
| 8 | 53260 | 53442 | - | NZ_CP011599.1 | Phytobacter ursingii |
| 9 | 84334 | 84516 | + | NZ_CP022359.1 | Shewanella bicestrii |
| 10 | 181512 | 181694 | + | NZ_CP045203.1 | Citrobacter telavivensis |
| 11 | 210813 | 210995 | - | NZ_CP011601.1 | Phytobacter ursingii |
| 12 | 116339 | 116521 | - | NZ_CP061512.1 | Mixta calida |
| 13 | 149447 | 149629 | + | NZ_CP041248.1 | Raoultella electrica |
| 14 | 91308 | 91490 | - | NZ_CP041248.1 | Raoultella electrica |
| 15 | 1369736 | 1369918 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 16 | 35725 | 35907 | - | NC_008344.1 | Nitrosomonas eutropha C91 |
| 17 | 301208 | 301390 | - | NZ_CP029396.2 | Acinetobacter defluvii |
| 18 | 16821 | 17003 | - | NZ_CP046027.1 | Neisseria brasiliensis |
| 19 | 1269997 | 1270143 | - | NC_007953.1 | Paraburkholderia xenovorans LB400 |
| 20 | 465829 | 465975 | - | NZ_CP059082.1 | Halomonas titanicae |
| 21 | 72214 | 72396 | - | NZ_CP062807.1 | Cupriavidus basilensis |
| 22 | 1300 | 1482 | + | NZ_CP032520.1 | Cupriavidus oxalaticus |
| 23 | 77659 | 77841 | - | NZ_CP032520.1 | Cupriavidus oxalaticus |
| 24 | 557881 | 558063 | + | NZ_CP032520.1 | Cupriavidus oxalaticus |
| 25 | 825492 | 825674 | - | NZ_CP028901.1 | Algicoccus marinus |
| 26 | 1106330 | 1106506 | + | NZ_CP027669.1 | Simplicispira suum |
| 27 | 18158 | 18340 | + | NZ_CP027670.1 | Simplicispira suum |
| 28 | 158361 | 158543 | + | NZ_CP011600.1 | Phytobacter ursingii |
| 29 | 317716 | 317898 | - | NZ_CP005961.1 | Pseudomonas mandelii JR-1 |
| 30 | 326461 | 326643 | - | NZ_CP009365.1 | Pseudomonas soli |
| 31 | 3097059 | 3097241 | - | NZ_CP054626.1 | Cupriavidus gilardii |
| 32 | 1752498 | 1752644 | + | NC_007908.1 | Rhodoferax ferrireducens T118 |
| 33 | 1402320 | 1402526 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 34 | 574352 | 574534 | - | NZ_AP018560.1 | Aerosticca soli |
| 35 | 23476 | 23658 | + | NZ_CP035902.1 | Burkholderia glumae |
| 36 | 214235 | 214417 | + | NZ_CP035902.1 | Burkholderia glumae |
| 37 | 2257900 | 2258082 | - | NC_020541.1 | Rhodanobacter denitrificans |
| 38 | 2016881 | 2017063 | - | NC_020541.1 | Rhodanobacter denitrificans |
| 39 | 2225726 | 2225908 | + | NC_020541.1 | Rhodanobacter denitrificans |
| 40 | 5047067 | 5047243 | + | NZ_CP065748.1 | Delftia lacustris |
| 41 | 3782800 | 3782976 | - | NZ_CP017420.1 | Delftia tsuruhatensis |
| 42 | 1424108 | 1424326 | + | NC_002977.6 | Methylococcus capsulatus str. Bath |
| 43 | 180735 | 180914 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 44 | 2956351 | 2956518 | + | NZ_CP020931.1 | Marinobacter salarius |
| 45 | 4761960 | 4762142 | + | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 46 | 2477891 | 2478040 | - | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 47 | 3132343 | 3132504 | - | NC_007484.1 | Nitrosococcus oceani ATCC 19707 |
| 48 | 74781 | 74927 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 49 | 1789055 | 1789255 | + | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 50 | 979374 | 979556 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 51 | 1491161 | 1491343 | + | NZ_CP021359.1 | Acidovorax carolinensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_016846.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07992.16 | 0.89 | 34 | 1096 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 2 | PF02852.24 | 0.89 | 34 | 1096 | same-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
| 3 | PF00070.29 | 0.87 | 33 | 1094.0 | same-strand | Pyridine nucleotide-disulphide oxidoreductase |
| 4 | PF09278.13 | 0.97 | 37 | -182 | opposite-strand | MerR, DNA binding |
| 5 | PF13411.8 | 1.0 | 38 | -182.0 | opposite-strand | MerR HTH family regulatory protein |
| 6 | PF00376.25 | 0.97 | 37 | -182 | opposite-strand | MerR family regulatory protein |
| 7 | PF00403.28 | 0.84 | 32 | 597 | same-strand | Heavy-metal-associated domain |
| 8 | PF02411.17 | 0.79 | 30 | 206.0 | same-strand | MerT mercuric transport protein |
++ More..