Result : P04124
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Light-harvesting protein B-1015 beta chain (Antenna pigment protein beta chain) |
| NCBI Accession ID | M55261.1 |
| Organism | Blastochloris viridis (Rhodopseudomonas viridis) |
| Left | 958 |
| Right | 1167 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGACTTGAAACCGAGCCTGACAGGGTTGACGGAAGAAGAGGCGAAGGAGTTCCACGGGATCTTCGTGACCTCGACGGTTCTGTACCTCGCGACCGCCGTGATCGTTCACTACCTGGTGTGGACGGCTCGTCCGTGGATCGCTCCCATCCCGAAGGGCTGGGTGAATCTGGAAGGCGTCCAGTCGGCGCTTTCGTATCTGGTCTGA |
| Sequence | MADLKPSLTGLTEEEAKEFHGIFVTSTVLYLATAVIVHYLVWTARPWIAPIPKGWVNLEGVQSALSYLV |
| Source of smORF | Swiss-Prot |
| Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
| Pubmed ID | 1693143 3890891 |
| Domain | CDD:395441 |
| Functional Category | Metal-binding |
| Uniprot ID | P04124 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 657228 | 657437 | + | NZ_CP012946.1 | Blastochloris viridis |
| 2 | 294112 | 294321 | + | NZ_AP018907.1 | Blastochloris tepida |
| 3 | 2957805 | 2958041 | - | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 4 | 2412025 | 2412261 | - | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 5 | 3201483 | 3201719 | - | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 6 | 6685351 | 6685566 | - | NZ_CP029550.1 | Methylobacterium durans |
| 7 | 2833279 | 2833515 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 8 | 2831493 | 2831723 | + | NZ_CP039546.1 | Methylorubrum populi |
| 9 | 1022100 | 1022324 | - | NZ_CP032509.1 | Georhizobium profundi |
| 10 | 1524260 | 1524487 | - | NC_008789.1 | Halorhodospira halophila SL1 |
| 11 | 5157848 | 5158066 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 12 | 2018900 | 2019118 | + | NC_017082.1 | Bradyrhizobium cosmicum |
| 13 | 254682 | 254900 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012946.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00142.20 | 0.92 | 12 | 3402.5 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
| 2 | PF01656.25 | 0.92 | 12 | 3402.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 3 | PF00148.21 | 0.92 | 12 | 1050.0 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 4 | PF08369.12 | 0.92 | 12 | 389.0 | same-strand | Proto-chlorophyllide reductase 57 kD subunit |
| 5 | PF00556.22 | 1.0 | 13 | 13 | same-strand | Antenna complex alpha/beta subunit |
| 6 | PF00124.21 | 0.92 | 12 | 806.5 | same-strand | Photosynthetic reaction centre protein |
| 7 | PF02276.20 | 0.77 | 10 | 2179.5 | same-strand | Photosynthetic reaction centre cytochrome C subunit |
++ More..