Result : P04123
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Light-harvesting protein B-1015 alpha chain (Antenna pigment protein alpha chain) |
| NCBI Accession ID | M55261.1 |
| Organism | Blastochloris viridis (Rhodopseudomonas viridis) |
| Left | 1185 |
| Right | 1394 |
| Strand | + |
| Nucleotide Sequence | ATGGCTACCGAATATCGCACTGCTTCCTGGAAGCTCTGGCTGATCCTGGATCCGCGCCGCGTTCTGACCGCTCTGTTCGTCTACCTGACGGTCATCGCTCTGCTCATCCACTTCGGTCTGCTCAGCACCGATCGTCTGAACTGGTGGGAATTCCAGCGCGGCCTTCCGAAGGCGGCGTCGCTCGTGGTCGTTCCGCCGGCTGTCGGCTGA |
| Sequence | MATEYRTASWKLWLILDPRRVLTALFVYLTVIALLIHFGLLSTDRLNWWEFQRGLPKAASLVVVPPAVG |
| Source of smORF | Swiss-Prot |
| Function | Antenna complexes are light-harvesting systems, which transfer the excitation energy to the reaction centers. |
| Pubmed ID | 1693143 3890891 |
| Domain | CDD:395441 |
| Functional Category | Metal-binding |
| Uniprot ID | P04123 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 657455 | 657664 | + | NZ_CP012946.1 | Blastochloris viridis |
| 2 | 294337 | 294546 | + | NZ_AP018907.1 | Blastochloris tepida |
| 3 | 6685152 | 6685337 | - | NZ_CP029550.1 | Methylobacterium durans |
| 4 | 2831735 | 2831923 | + | NZ_CP039546.1 | Methylorubrum populi |
| 5 | 2230863 | 2231075 | + | NC_011666.1 | Methylocella silvestris BL2 |
| 6 | 2833541 | 2833714 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 7 | 2177315 | 2177512 | - | NC_018012.1 | Thiocystis violascens DSM 198 |
| 8 | 542404 | 542574 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 9 | 254920 | 255096 | + | NC_014664.1 | Rhodomicrobium vannielii ATCC 17100 |
| 10 | 2884702 | 2884896 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 11 | 6695796 | 6695966 | - | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 12 | 2994819 | 2994989 | - | NZ_CP007031.1 | Marichromatium purpuratum 984 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP012946.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00142.20 | 0.83 | 10 | 3686.5 | same-strand | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
| 2 | PF01656.25 | 0.83 | 10 | 3686.5 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 3 | PF00148.21 | 1.0 | 12 | 948 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 4 | PF08369.12 | 1.0 | 12 | 645.5 | same-strand | Proto-chlorophyllide reductase 57 kD subunit |
| 5 | PF00556.22 | 1.0 | 12 | 57.5 | same-strand | Antenna complex alpha/beta subunit |
| 6 | PF00124.21 | 1.0 | 12 | 609.0 | same-strand | Photosynthetic reaction centre protein |
| 7 | PF02276.20 | 0.83 | 10 | 1953.0 | same-strand | Photosynthetic reaction centre cytochrome C subunit |
++ More..