Result : P03051
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Regulatory protein rop (RNA one modulator) (ROM) |
| NCBI Accession ID | J01749.1 |
| Organism | Escherichia coli |
| Left | 1915 |
| Right | 2106 |
| Strand | + |
| Nucleotide Sequence | GTGACCAAACAGGAAAAAACCGCCCTTAACATGGCCCGCTTTATCAGAAGCCAGACATTAACGCTTCTGGAGAAACTCAACGAGCTGGACGCGGATGAACAGGCAGACATCTGTGAATCGCTTCACGACCACGCTGATGAGCTTTACCGCAGCTGCCTCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGA |
| Sequence | MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHADELYRSCLARFGDDGENL |
| Source of smORF | Swiss-Prot |
| Function | Regulates plasmid DNA replication by modulating the initiation of transcription of the primer RNA precursor. Processing of the precursor of the primer, RNAII, is inhibited by hydrogen bonding of RNAII to its complementary sequence in RNAI. ROP increases the affinity of RNAI for RNAII and thus decreases the rate of replication initiation events. |
| Pubmed ID | 6183660 6304700 383387 2223771 3681971 8548455 10089502 1841691 |
| Domain | CDD:307776 |
| Functional Category | Others |
| Uniprot ID | P03051 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1845 | 2036 | - | NZ_CP011006.1 | Psychromicrobium lacuslunae |
| 2 | 2124 | 2318 | - | NZ_CP061529.1 | Shigella dysenteriae |
| 3 | 1584 | 1772 | - | NZ_AP018934.1 | Zymobacter palmae |
| 4 | 575 | 766 | - | NC_016847.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 5 | 145 | 324 | + | NC_009793.1 | Citrobacter koseri ATCC BAA-895 |
| 6 | 581 | 772 | - | NZ_CP065840.1 | Klebsiella quasipneumoniae |
++ More..