Result : P02986
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cloacin immunity protein |
| NCBI Accession ID | X04466.1 |
| Organism | Escherichia coli |
| Left | 1167 |
| Right | 1424 |
| Strand | - |
| Nucleotide Sequence | ATGGGGCTTAAATTACATATTCATTGGTTTGATAAGAAAACCGAAGAGTTTAAAGGCGGTGAATACTCAAAAGACTTCGGTGATGATGGTTCTGTCATTGAAAGTCTGGGGATGCCTTTAAAGGATAATATTAATAATGGTTGGTTTGATGTTGAAAAACCATGGGTTTCGATATTACAGCCACACTTTAAAAATGTAATCGATATTAGTAAATTTGATTACTTTGTATCCTTTGTTTACCGGGATGGTAACTGGTAA |
| Sequence | MGLKLHIHWFDKKTEEFKGGEYSKDFGDDGSVIESLGMPLKDNINNGWFDVEKPWVSILQPHFKNVIDISKFDYFVSFVYRDGNW |
| Source of smORF | Swiss-Prot |
| Function | This protein complexes with cloacin protein in equimolar amounts and inhibits it by binding with high affinity to the C-terminal catalytic domain of cloacin. |
| Pubmed ID | 3749334 6163089 6253914 |
| Domain | CDD:281508 |
| Functional Category | Others |
| Uniprot ID | P02986 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5299 | 5556 | - | NC_009793.1 | Citrobacter koseri ATCC BAA-895 |
| 2 | 1709860 | 1710114 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 3 | 2869072 | 2869326 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 4 | 2800541 | 2800795 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 5 | 1016785 | 1017039 | - | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 6 | 1384852 | 1385106 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 7 | 5087519 | 5087773 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 8 | 4502100 | 4502354 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 9 | 3829640 | 3829894 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
| 10 | 1135436 | 1135690 | - | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 11 | 4163887 | 4164135 | + | NZ_FO704550.1 | Xenorhabdus doucetiae |
| 12 | 1932337 | 1932591 | + | NZ_CP029736.1 | Providencia rettgeri |
| 13 | 1503007 | 1503261 | - | NZ_CP029608.1 | Pseudomonas kribbensis |
| 14 | 738950 | 739204 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134475.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09000.12 | 0.79 | 11 | 9 | same-strand | Cytotoxic |
| 2 | PF06958.14 | 0.71 | 10 | 9.5 | same-strand | S-type Pyocin |
++ More..