Result : P00273
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Desulforedoxin (DX) |
| NCBI Accession ID | M62784.1 |
| Organism | Desulfovibrio gigas |
| Left | 113 |
| Right | 226 |
| Strand | + |
| Nucleotide Sequence | ATGGCGAACGAAGGCGACGTGTACAAGTGTGAACTGTGCGGCCAGGTGGTGAAAGTGCTGGAAGAAGGCGGCGGCACGCTGGTGTGCTGCGGCGAGGATATGGTCAAGCAGTAA |
| Sequence | MANEGDVYKCELCGQVVKVLEEGGGTLVCCGEDMVKQ |
| Source of smORF | Swiss-Prot |
| Function | Nonheme iron protein possibly involved in electron transport. |
| Pubmed ID | 2254288 508323 7666420 10422844 9568899 |
| Domain | CDD:350864 |
| Functional Category | Metal-binding |
| Uniprot ID | P00273 |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 28
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3007134 | 3007232 | - | NC_007796.1 | Methanospirillum hungatei JF-1 |
| 2 | 84222 | 84344 | - | NC_018227.2 | Methanoculleus bourgensis MS2 |
| 3 | 2914510 | 2914626 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 4 | 188578 | 188694 | - | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 5 | 44973 | 45092 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 6 | 2635698 | 2635826 | - | NC_014507.1 | Methanolacinia petrolearia DSM 11571 |
| 7 | 151195 | 151317 | - | NC_009051.1 | Methanoculleus marisnigri JR1 |
| 8 | 62235 | 62360 | + | NC_019943.1 | Methanoregula formicica SMSP |
| 9 | 318775 | 318897 | - | NZ_AP019781.1 | Methanoculleus chikugoensis |
| 10 | 2916056 | 2916181 | - | NZ_CP009515.1 | Methanosarcina lacustris Z-7289 |
| 11 | 70951 | 71079 | - | NC_009712.1 | Methanoregula boonei 6A8 |
| 12 | 2202008 | 2202133 | - | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 13 | 1480987 | 1481112 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 14 | 4611437 | 4611562 | + | NC_003552.1 | Methanosarcina acetivorans C2A |
| 15 | 3967583 | 3967708 | + | NZ_CP009506.1 | Methanosarcina siciliae T4/M |
| 16 | 1857781 | 1857903 | + | NC_017527.1 | Methanosaeta harundinacea 6Ac |
| 17 | 1073736 | 1073861 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 18 | 952981 | 953106 | - | NZ_CP009516.1 | Methanosarcina horonobensis HB-1 = JCM 15518 |
| 19 | 760519 | 760644 | + | NC_003901.1 | Methanosarcina mazei Go1 |
| 20 | 336194 | 336316 | + | NC_011832.1 | Methanosphaerula palustris E1-9c |
| 21 | 1888923 | 1889036 | - | NC_015676.1 | Methanosalsum zhilinae DSM 4017 |
| 22 | 1319556 | 1319687 | + | NC_012785.1 | Kosmotoga olearia TBF 19.5.1 |
| 23 | 1788725 | 1788832 | + | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 24 | 1794626 | 1794754 | + | NZ_CP011232.1 | Kosmotoga pacifica |
| 25 | 1212689 | 1212811 | - | NZ_CP017921.1 | Methanohalophilus halophilus |
| 26 | 1509683 | 1509805 | + | NC_014002.1 | Methanohalophilus mahii DSM 5219 |
| 27 | 1280140 | 1280268 | - | NZ_CP009530.1 | Methanosarcina barkeri 227 |
| 28 | 1989834 | 1989959 | - | NZ_CP009520.1 | Methanosarcina vacuolata Z-761 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_007796.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02627.22 | 0.64 | 18 | 537.0 | same-strand | Carboxymuconolactone decarboxylase family |
++ More..