Protein Information |
Information Type | Description |
---|---|
Protein name | Ferredoxin-1 (Ferredoxin I) (FdI) |
NCBI Accession ID | AJ489482.1 |
Organism | Desulfocurvibacter africanus (Desulfovibrio africanus) |
Left | 501 |
Right | 698 |
Strand | + |
Nucleotide Sequence | ATGGCTCGCAAGTTCTATGTAGACCAGGACGAATGCATTGCCTGCGAATCCTGCGTGGAGATCGCACCGGGCGCCTTTGCCATGGACCCGGAGATTGAGAAGGCCTATGTCAAGGACGTGGAGGGCGCCAGCCAGGAAGAAGTCGAGGAGGCCATGGATACCTGCCCTGTGCAGTGCATCCATTGGGAGGACGAGTAG |
Sequence | MARKFYVDQDECIACESCVEIAPGAFAMDPEIEKAYVKDVEGASQEEVEEAMDTCPVQCIHWEDE |
Source of smORF | Swiss-Prot |
Function | Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions. |
Pubmed ID | 7126685 7803404 9533888 |
Domain | CDD:418523 |
Functional Category | Metal-binding |
Uniprot ID | P00210 |
ORF Length (Amino Acid) | 65 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1161919 | 1162116 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
2 | 4062378 | 4062575 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
3 | 198245 | 198424 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
4 | 3793879 | 3794067 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
5 | 3495593 | 3495784 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
6 | 1230070 | 1230264 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
7 | 259323 | 259514 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
8 | 3150361 | 3150552 | - | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
9 | 114098 | 114286 | + | NZ_CP009788.1 | Geobacter pickeringii |
10 | 354981 | 355175 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
11 | 1538981 | 1539175 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
12 | 2947069 | 2947260 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
13 | 311099 | 311278 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |