| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | CP000557.1 |
| Organism | Geobacillus thermodenitrificans (strain NG80-2) |
| Left | 435088 |
| Right | 435372 |
| Strand | - |
| Nucleotide Sequence | ATGAAACGGGTTCATGTCATTGTCGAAGGACGTGTACAAGGTGTTGGCTTTCGCTATTTCGTCCAGCACGAGGCACTGAAGCGACAGCTGACCGGCTGGGTAAAAAACAATGACGATGGGACGGTGGAAATGGAAGCCCAAGGCCATGAAAGTGCCGTCCAGCTCTTTTTGGATACGATTGAAGCCGGAACGATGTTTGCTAAAGTCTCTCGTATGCACATTGAGCAGCGCGACGTCCGACCGGATGAAAAACAATTTCGCATTATGTACGGCGGCGGGCTTTAA |
| Sequence | MKRVHVIVEGRVQGVGFRYFVQHEALKRQLTGWVKNNDDGTVEMEAQGHESAVQLFLDTIEAGTMFAKVSRMHIEQRDVRPDEKQFRIMYGGGL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 17372208 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | A4IKB1 |
| ORF Length (Amino Acid) | 94 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2787544 | 2787822 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 2 | 455690 | 455974 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 3 | 3487750 | 3488034 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 4 | 1811001 | 1811285 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 5 | 3145574 | 3145858 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 6 | 1138352 | 1138624 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 7 | 87123 | 87395 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 8 | 3592760 | 3593032 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 9 | 807655 | 807927 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 10 | 799713 | 799985 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 11 | 2355606 | 2355878 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 12 | 1818145 | 1818417 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 13 | 316707 | 316985 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 14 | 4826730 | 4827002 | + | NZ_CP043998.1 | Clostridium diolis |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01583.22 | 0.64 | 9 | 1771 | same-strand | Adenylylsulphate kinase |
| 2 | PF13238.8 | 0.64 | 9 | 1771 | same-strand | AAA domain |
| 3 | PF00590.22 | 0.71 | 10 | 860.0 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 4 | PF01903.19 | 0.71 | 10 | 89.0 | same-strand | CbiX |
| 5 | PF08830.12 | 0.64 | 9 | 1096 | same-strand | Protein of unknown function (DUF1806) |
| 6 | PF02585.19 | 0.64 | 9 | 1457 | same-strand | GlcNAc-PI de-N-acetylase |