Result : P00137
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cytochrome c3 (Cytochrome c551.5) (Cytochrome c7) |
| NCBI Accession ID | |
| Organism | Desulfuromonas acetoxidans (Chloropseudomonas ethylica) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK |
| Source of smORF | Swiss-Prot |
| Function | Participates in sulfate respiration coupled with phosphorylation by transferring electrons from the enzyme dehydrogenase to ferredoxin. {ECO:0000269|Pubmed:12119407}. |
| Pubmed ID | 11946160 9546165 9030775 12119407 11320307 8962062 9760163 10561607 11883773 |
| Domain | |
| Functional Category | Metal-binding |
| Uniprot ID | P00137 |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 795415 | 795618 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 2 | 2932538 | 2932711 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 3 | 3886560 | 3886775 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 4 | 4444761 | 4444967 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 5 | 4440989 | 4441195 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 6 | 3966752 | 3966967 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 7 | 4601029 | 4601274 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 8 | 3389687 | 3389932 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 9 | 681278 | 681472 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 10 | 1577720 | 1577938 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 11 | 684696 | 684914 | - | NC_011979.1 | Geobacter daltonii FRC-32 |
| 12 | 4783259 | 4783501 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 13 | 4488533 | 4488751 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 14 | 4779786 | 4780004 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 15 | 3188414 | 3188590 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 16 | 397074 | 397280 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 17 | 1922171 | 1922413 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 18 | 1104055 | 1104261 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 19 | 3563840 | 3564016 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 20 | 2960072 | 2960251 | - | NC_010814.1 | Geobacter lovleyi SZ |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011979.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13307.8 | 0.6 | 6 | 132 | same-strand | Helicase C-terminal domain |
| 2 | PF14522.8 | 0.7 | 7 | 3224 | opposite-strand | Cytochrome c7 and related cytochrome c |
| 3 | PF01381.24 | 0.7 | 7 | 636.0 | opposite-strand | Helix-turn-helix |
| 4 | PF13560.8 | 0.7 | 7 | 636.0 | opposite-strand | Helix-turn-helix domain |
| 5 | PF12844.9 | 0.7 | 7 | 636.0 | opposite-strand | Helix-turn-helix domain |
| 6 | PF04055.23 | 0.6 | 6 | 1552.5 | opposite-strand | Radical SAM superfamily |
++ More..